Oncorhynchus nerka (sockeye salmon): 115133756 Help Entry 115133756         CDS       T07952                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04060   Cytokine-cytokine receptor interaction one04218   Cellular senescence one04620   Toll-like receptor signaling pathway one04621   NOD-like receptor signaling pathway one04622   RIG-I-like receptor signaling pathway one05132   Salmonella infection Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115133756  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     115133756  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115133756    04621 NOD-like receptor signaling pathway     115133756    04622 RIG-I-like receptor signaling pathway     115133756  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115133756  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:one04052]     115133756    00536 Glycosaminoglycan binding proteins [BR:one00536]     115133756 Cytokines and neuropeptides [BR:one04052]  Cytokines   Chemokines    115133756 Glycosaminoglycan binding proteins [BR:one00536]  Heparan sulfate / Heparin   Chemokines    115133756 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  115133756 NCBI-ProteinID:  XP_029523102 LinkDB All DBs Position LG8:21142210..21144563 Genome browser AA seq 115 aa AA seqDB search MNTASITIILLTLLSIFSTTEGIKQPRVLRCLCPKVQAGLIPFRDLKSVWHLSPRPHCSK TEVIVTLKRGGQLCLDPKKRLVKILVERSTKRMQESKRSKEVGSVTPALLHLSTR NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaacaccgcaagtataaccatcattctgctcacccttctgtccatcttctcaacaact gaagggataaagcaaccacgggttctacgctgcctttgccccaaagtgcaggctggtctt attccgttcagggatttgaagagtgtgtggcacctctctcctcgcccacactgttcaaag actgaagtcattgtcacactcaaaaggggaggtcaactctgcctggacccaaagaaacgt ttggtgaagattctggtggagagatcaaccaaaagaatgcaggaaagcaaacgttctaaa gaggttggaagcgtcactcctgccctgttacacttgtcaaccagatga

DBGET integrated database retrieval system