Oncorhynchus nerka (sockeye salmon): 115134169 Help Entry 115134169         CDS       T07952                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04012   ErbB signaling pathway one04068   FoxO signaling pathway one04137   Mitophagy - animal one04140   Autophagy - animal one04144   Endocytosis one04150   mTOR signaling pathway one04210   Apoptosis one04218   Cellular senescence one04370   VEGF signaling pathway one04371   Apelin signaling pathway one04510   Focal adhesion one04540   Gap junction one04625   C-type lectin receptor signaling pathway one04810   Regulation of actin cytoskeleton one04910   Insulin signaling pathway one04912   GnRH signaling pathway one04916   Melanogenesis one05132   Salmonella infection Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115134169 (hras)    04012 ErbB signaling pathway     115134169 (hras)    04370 VEGF signaling pathway     115134169 (hras)    04371 Apelin signaling pathway     115134169 (hras)    04068 FoxO signaling pathway     115134169 (hras)    04150 mTOR signaling pathway     115134169 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115134169 (hras)    04140 Autophagy - animal     115134169 (hras)    04137 Mitophagy - animal     115134169 (hras)   09143 Cell growth and death    04210 Apoptosis     115134169 (hras)    04218 Cellular senescence     115134169 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     115134169 (hras)    04540 Gap junction     115134169 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     115134169 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115134169 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     115134169 (hras)    04912 GnRH signaling pathway     115134169 (hras)    04916 Melanogenesis     115134169 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115134169 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:one04131]     115134169 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115134169 (hras)    04031 GTP-binding proteins [BR:one04031]     115134169 (hras) Membrane trafficking [BR:one04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     115134169 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     115134169 (hras) Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115134169 (hras)   Exosomal proteins of colorectal cancer cells    115134169 (hras) GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115134169 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin AAA_16 Motif Other DBs NCBI-GeneID:  115134169 NCBI-ProteinID:  XP_029523731 LinkDB All DBs Position LG9a:16480667..16512967 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatacgaccccaccatagaggactcatac aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatc aagcgtgtgaaagactctgacgacgtgcccatggtcctggtgggtaataaatgtgacctt ccatcgcgtaccgtggacacgcggcaagcacaggaactggcccgcagctacggaattccc tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgctagtg agagagatcaggcagcacaagctgaggaagctcaaccctccggacgagagtggacaggac tgcatgagctgccgctgtgtggtgtcgtga

DBGET integrated database retrieval system