Oncorhynchus nerka (sockeye salmon): 115143336 Help Entry 115143336         CDS       T07952                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04137   Mitophagy - animal one04140   Autophagy - animal one04144   Endocytosis one04145   Phagosome one04148   Efferocytosis one05132   Salmonella infection Brite KEGG Orthology (KO) [BR:one00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115143336    04145 Phagosome     115143336    04140 Autophagy - animal     115143336    04137 Mitophagy - animal     115143336    04148 Efferocytosis     115143336  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115143336  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:one04131]     115143336   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115143336    04031 GTP-binding proteins [BR:one04031]     115143336 Membrane trafficking [BR:one04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     115143336 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115143336   Exosomal proteins of other body fluids (saliva and urine)    115143336   Exosomal proteins of colorectal cancer cells    115143336   Exosomal proteins of bladder cancer cells    115143336 GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     115143336 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  115143336 NCBI-ProteinID:  XP_029539503 LinkDB All DBs Position LG15:45269583..45281947 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaagtactactcaaagtcatcatcctgggagactctggagttggg aagacgtcgctgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggagctgatttcctaacgaaagaagtgatggtggatgacagacttgtcaccatgcag atctgggacactgcagggcaggagaggttccagtctctgggtgtagcgttctaccgcggg gcagactgctgtgtgctggtgtttgacgtgactgcccccaacacctttaagacgctagac agctggagggacgagttccttatacaggccagcccccgagatcccgagaacttccccttt gtggtgctaggcaacaagattgacttggagaacagacaggtgacgaccaaacgagcacag gcgtggtgtcagagcaagaacaacatcccctacttcgagaccagcgctaaggaggccatc aacgttgaacaggctttccagactatcgcacgcaatgctcttaaacaggagacagaggta gagttgtacaatgagtttcctgaaccgataaagctggacaggaacgaacgggccaagcca tcagcggaggcctgcagctgctga

DBGET integrated database retrieval system