Oncorhynchus nerka (sockeye salmon): 115145229 Help Entry 115145229         CDS       T07952                                  Name (RefSeq) ras-related protein R-Ras-like   KO K07830   Ras-related protein R-Ras2 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04137   Mitophagy - animal one04140   Autophagy - animal one04218   Cellular senescence one04371   Apelin signaling pathway one04625   C-type lectin receptor signaling pathway one04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115145229    04371 Apelin signaling pathway     115145229  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115145229    04137 Mitophagy - animal     115145229   09143 Cell growth and death    04218 Cellular senescence     115145229   09142 Cell motility    04810 Regulation of actin cytoskeleton     115145229  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115145229  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115145229    04031 GTP-binding proteins [BR:one04031]     115145229 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115145229   Exosomal proteins of bladder cancer cells    115145229 GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115145229 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  115145229 NCBI-ProteinID:  XP_029542501 LinkDB All DBs Position LG17:27745863..27766722 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRVISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSDGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaagctggtcgtcgtgggcgggggcggtgtggggaaa agtgccttgaccatacaattcattcagtcatactttgtatcggattatgacccaaccatc gaggactcctacaccaaaatatgcacagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaagaggagtttggggcaatgagggagcagtacatgcgctcaggagaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagtgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagacgaagcc ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaagagcgatggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system