Oncorhynchus nerka (sockeye salmon): 115145229 Help Entry 115145229         CDS       T07952                                  Name (RefSeq) ras-related protein R-Ras-like   KO K07830   Ras-related protein R-Ras2 Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04137   Mitophagy - animal one04140   Autophagy - animal one04218   Cellular senescence one04371   Apelin signaling pathway one04519   Cadherin signaling one04625   C-type lectin receptor signaling pathway one04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115145229    04371 Apelin signaling pathway     115145229   09133 Signaling molecules and interaction    04519 Cadherin signaling     115145229  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115145229    04137 Mitophagy - animal     115145229   09143 Cell growth and death    04218 Cellular senescence     115145229   09142 Cell motility    04810 Regulation of actin cytoskeleton     115145229  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115145229  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115145229    04031 GTP-binding proteins [BR:one04031]     115145229 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115145229   Exosomal proteins of bladder cancer cells    115145229 GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115145229 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF192 Motif Other DBs NCBI-GeneID:  115145229 NCBI-ProteinID:  XP_029542501 LinkDB All DBs Position LG17:27745863..27766722 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRVISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSDGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaagctggtcgtcgtgggcgggggcggtgtggggaaa agtgccttgaccatacaattcattcagtcatactttgtatcggattatgacccaaccatc gaggactcctacaccaaaatatgcacagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaagaggagtttggggcaatgagggagcagtacatgcgctcaggagaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagtgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagacgaagcc ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaagagcgatggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system