Oreochromis niloticus (Nile tilapia): 100691816 Help Entry 100691816         CDS       T06104                                  Symbol npy Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04080   Neuroactive ligand-receptor interaction onl04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:onl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100691816 (npy)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     100691816 (npy)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:onl04052]     100691816 (npy) Cytokines and neuropeptides [BR:onl04052]  Neuropeptides   GPCR binding    100691816 (npy) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  100691816 NCBI-ProteinID:  XP_003448902 LinkDB All DBs Position LG22:complement(24823368..24825412) Genome browser AA seq 99 aa AA seqDB search MHPNLVSWLGTLGFLLWALVCLGALTEAYPVKPENPGEDAPAEELAKYYSALRHYINLIT RQRYGKRSSPEILDTLVSELLLKESTDTLPQSRYDPSMW NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcatcctaacttggtaagctggctggggactctggggttcctgctgtgggcgctggtc tgcttgggcgccttgacggaggcatacccagtgaaaccagagaaccccggggaggacgcc cctgcggaggagctggccaagtactactcagccctgagacattacatcaacctcattaca agacagaggtatgggaagagatccagtcctgagattctggacacactggtctcagagctg ctgctgaaggaaagcacagacacgcttccacagtcaagatatgacccatcaatgtggtga

DBGET integrated database retrieval system