Oreochromis niloticus (Nile tilapia): 100692536 Help Entry 100692536         CDS       T06104                                  Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04621   NOD-like receptor signaling pathway onl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:onl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100692536  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100692536  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:onl03110]     100692536 Chaperones and folding catalysts [BR:onl03110]  Protein folding catalysts   Protein disulfide isomerase    100692536 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin AhpC-TSA Thioredoxin_8 OST3_OST6 Thioredoxin_9 Thioredoxin_7 Thioredoxin_2 DIM1 Redoxin Thioredox_DsbH Motif Other DBs NCBI-GeneID:  100692536 NCBI-ProteinID:  XP_003447582 LinkDB All DBs Position LG3:22141302..22154685 Genome browser AA seq 107 aa AA seqDB search MVYDVKDLDEFQKILNDAGDKLVVVDFTAEWCGPCQMMAPIFVEMSEEPVNANVIFLKVD ANDGKDVKSFYNVTRMPAFHFYKNNQKVYEFTGADEAQLHQKVRELR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtttacgacgtgaaagatctggatgagttccagaaaatcctgaatgacgctggagac aagctggtggtggtggacttcacagccgagtggtgtggcccctgccaaatgatggcccca atttttgttgagatgtcagaggagcctgtcaacgcaaacgtgattttcctgaaggtggac gcaaatgatggcaaggatgtgaagtccttctataatgtcacccgcatgcccgcatttcac ttttacaagaataaccagaaggtgtatgagttcactggtgctgatgaagctcagctacat caaaaagtgagagagctcagatga

DBGET integrated database retrieval system