Oreochromis niloticus (Nile tilapia): 100692805 Help Entry 100692805         CDS       T06104                                  Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04621   NOD-like receptor signaling pathway onl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:onl00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100692805  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100692805  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:onl03110]     100692805 Chaperones and folding catalysts [BR:onl03110]  Protein folding catalysts   Protein disulfide isomerase    100692805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin OST3_OST6 Thioredoxin_9 Thioredoxin_2 AhpC-TSA DIM1 Thioredoxin_8 Redoxin Thioredoxin_7 BrxC Motif Other DBs NCBI-GeneID:  100692805 NCBI-ProteinID:  XP_003447577 Ensembl:  ENSONIG00000031591 UniProt:  I3K536 LinkDB All DBs Position LG3:complement(22108738..22128582) Genome browser AA seq 107 aa AA seqDB search MVRQVKDLEEFNKILREAGDKLVVVDFTATWCGPCRMIAPVYEKMAAESENANVIFLKVD VDAARDVSSSCGIRSMPTFHFYKNGQKVHEFSGADQAKLLQKVAELR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggttcgccaagtaaaagatctggaagagttcaataaaatcctgagagaagctggagac aagctggtggtggtggacttcacagccacttggtgtggcccctgccgaatgattgcccca gtgtatgagaaaatggcggcggagtcagagaatgcgaacgtgattttcctgaaggtggac gtggatgctgcccgtgatgtgtcctcatcctgtggaatcagatccatgcccacattccac ttttacaagaatggccaaaaggtccacgagttctccggagctgatcaagctaaactactt caaaaagtggcagagctgagataa

DBGET integrated database retrieval system