Oreochromis niloticus (Nile tilapia): 100693950 Help Entry 100693950         CDS       T06104                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04010   MAPK signaling pathway onl04137   Mitophagy - animal onl04140   Autophagy - animal onl04218   Cellular senescence onl04371   Apelin signaling pathway onl04519   Cadherin signaling onl04625   C-type lectin receptor signaling pathway onl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:onl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100693950 (rras2)    04371 Apelin signaling pathway     100693950 (rras2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     100693950 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100693950 (rras2)    04137 Mitophagy - animal     100693950 (rras2)   09143 Cell growth and death    04218 Cellular senescence     100693950 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100693950 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100693950 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:onl04147]     100693950 (rras2)    04031 GTP-binding proteins [BR:onl04031]     100693950 (rras2) Exosome [BR:onl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100693950 (rras2)   Exosomal proteins of bladder cancer cells    100693950 (rras2) GTP-binding proteins [BR:onl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100693950 (rras2) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SLFN-g3_helicase ATP_bind_1 RHG35-p190PhoGP_pG1 FeoB_N Motif Other DBs NCBI-GeneID:  100693950 NCBI-ProteinID:  XP_003442340 Ensembl:  ENSONIG00000006123 UniProt:  I3JFS4 LinkDB All DBs Position LG1:19883357..19911879 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKTGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggaaggacggctcggtgcaggagaagtatcgcctggttgtggtcggagga ggtggcgtcgggaaatcagccctgactatccagtttattcagtcgtactttgtcactgac tatgacccgacaattgaagactcttataccaagcagtgtgtgatcgacgaaaggccggcc aggctcgacatcctcgacacggctggacaggaagagtttggagccatgagagaacaatac atgaggacaggggagggcttcctgctcgtcttctcagtcaccgacagaggaagctttgaa gaaatctacaaattccaaagacagattctccgagtcaaagacagagacgaattcccgatg atccttgtaggaaacaaagcagatctggaactacagagacaagtaacccaggaagagggc cagcagctggccagacaattaaaggtcacatacatggaggcttcagctaaaatacgaatg aacgtagaccaggctttccacgagctggttagagtaatcaggaaattccaagaacaggaa tgtccaccgtcgccagaacctacaaggaaagaaaaagacaagaccggctgccactgtgtg atcgtctga

DBGET integrated database retrieval system