Oreochromis niloticus (Nile tilapia): 100694823 Help Entry 100694823         CDS       T06104                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism onl  Oreochromis niloticus (Nile tilapia) Brite KEGG Orthology (KO) [BR:onl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:onl03041]     100694823 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:onl04052]     100694823 (ubl5) Spliceosome [BR:onl03041]  Complex B   Other components    Complex B specific factors     100694823 (ubl5) Cytokines and neuropeptides [BR:onl04052]  Neuropeptides   Unclassified    100694823 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler DUF5343 OTU1_UBXL Motif Other DBs NCBI-GeneID:  100694823 NCBI-ProteinID:  XP_003457801 Ensembl:  ENSONIG00000000251 UniProt:  I3IUN1 LinkDB All DBs Position LG6:complement(12303322..12305589) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRHDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaagtggtttgcaacgaccgtctaggcaagaaagtccgggtcaagtgcaactct gaggataccatcggagatctgaagaagctcatagctgcccagacaggaacacggcatgat aagatcgtgctaaagaaatggtacaccatattcaaggaccacgtgtctctgggtgactat gaaatccatgatgggatgaaccttgagctgtactaccagtaa

DBGET integrated database retrieval system