Oreochromis niloticus (Nile tilapia): 100697089 Help Entry 100697089         CDS       T06104                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04382   Cornified envelope formation onl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:onl00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100697089  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100697089  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:onl04147]     100697089 Exosome [BR:onl04147]  Exosomal proteins   Exosomal proteins of microglial cells    100697089 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  100697089 NCBI-ProteinID:  XP_003452494 LinkDB All DBs Position LG22:complement(17139545..17141180) Genome browser AA seq 96 aa AA seqDB search MPSELENCMEGLIKVFHRYAKNGSLTRQNLRQLMEAELSSFLKCQKDPAAVDKIMKDLDA NGDGLVNFEEFVSLVVGLSVACEQCYQLEMKKTGKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaaaactgcatggaaggactcatcaaggtgttccaccgttacgcc aagaatggttcgctcacccggcaaaacctcagacagctaatggaggctgagctttccagc ttccttaagtgtcaaaaagatcctgctgctgtggacaagatcatgaaagacttggatgcc aacggtgatggtcttgtgaactttgaggagtttgtttctctggttgttggactgtctgtt gcctgtgagcagtgctatcagctggaaatgaagaagactggaaagaagtag

DBGET integrated database retrieval system