Oreochromis niloticus (Nile tilapia): 100699213 Help Entry 100699213         CDS       T06104                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04140   Autophagy - animal onl04150   mTOR signaling pathway onl04218   Cellular senescence onl04910   Insulin signaling pathway onl05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:onl00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     100699213 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100699213 (rheb)   09143 Cell growth and death    04218 Cellular senescence     100699213 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100699213 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100699213 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:onl04031]     100699213 (rheb) GTP-binding proteins [BR:onl04031]  Small (monomeric) G-proteins   Ras Family    Rheb     100699213 (rheb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SRPRB RhoGAP_pG2 RsgA_GTPase AAA_14 Reovirus_M2 YebF STIV_penton_2nd ParE_toxin Motif Other DBs NCBI-GeneID:  100699213 NCBI-ProteinID:  XP_003448514 Ensembl:  ENSONIG00000018507 UniProt:  A0A669BI50 LinkDB All DBs Position LG18:complement(24317187..24325942) Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITINGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVQVIHEKLLDMVGKVQVPIMLVGNK NDLHMERVISCEEGKALAESWNAAFMESSAKENQTAVEVFRRMILEAEKMDGGVQPGKTS CSMM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaaatcacgaaaaatcgccatcctcgggtacagatccgtaggaaagtcc tctttgaccatccagtttgtggaaggccagtttgttgattcctatgacccaacaatagaa aacacatttactaagatgatcacaataaatggacaagagtaccatctccagcttgtagac acagcagggcaggatgaatactcaatcttcccacagacttactccatagatatcaatggc tacatactggtctattcagttacatcaaataaaagctttgaagttgtacaagttatccat gaaaaactgttggacatggtgggaaaagttcaagttccaattatgctcgtcggaaacaag aatgacctacatatggagcgagtaatcagttgtgaagagggaaaagcattagctgaatcc tggaacgctgccttcatggagtcctcagctaaagagaaccagacggccgtggaggttttc cgaaggatgatcctggaggcagaaaagatggacggtggcgtgcagccaggaaaaacatcc tgctccatgatgtag

DBGET integrated database retrieval system