Oreochromis niloticus (Nile tilapia): 100703096 Help Entry 100703096         CDS       T06104                                  Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism onl  Oreochromis niloticus (Nile tilapia) Brite KEGG Orthology (KO) [BR:onl00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:onl04147]     100703096    04090 CD molecules [BR:onl04090]     100703096    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:onl00537]     100703096 Exosome [BR:onl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100703096   Exosomal proteins of other body fluids (saliva and urine)    100703096   Exosomal proteins of colorectal cancer cells    100703096 CD molecules [BR:onl04090]  Proteins   100703096 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:onl00537]  Antigens   100703096 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  100703096 NCBI-ProteinID:  XP_005457336 Ensembl:  ENSONIG00000031414 LinkDB All DBs Position LG22:18098745..18101852 Genome browser AA seq 107 aa AA seqDB search MRSSVVFCLAVSFAMFGFGLSLQCYSCPGGSSQNCAAKQECTQGKDACLKLTSGGKTYTE CLRYADCDFMTLAVRYSLPDFTFSCCQKTLCNGEEKTFLQKLKDFFG NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaggagctctgtggtgttttgcctagctgtcagctttgccatgtttggatttggcctc tcgctgcagtgttactcctgcccgggtgggtcctcccagaactgtgcagccaagcaggag tgtacccaggggaaggacgcctgcctcaaactcaccagtggtggcaagacctacactgaa tgtttgcggtatgcagactgtgacttcatgactctggctgtcagatactccctccccgac ttcaccttctcctgttgtcagaaaacactctgcaatggtgaagaaaagactttccttcag aaattgaaagatttctttggttaa

DBGET integrated database retrieval system