Oreochromis niloticus (Nile tilapia): 100704156 Help Entry 100704156         CDS       T06104                                  Name (RefSeq) insulin   KO K04526   insulin Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04010   MAPK signaling pathway onl04068   FoxO signaling pathway onl04081   Hormone signaling onl04114   Oocyte meiosis onl04140   Autophagy - animal onl04150   mTOR signaling pathway onl04810   Regulation of actin cytoskeleton onl04910   Insulin signaling pathway onl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:onl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100704156    04068 FoxO signaling pathway     100704156    04150 mTOR signaling pathway     100704156   09133 Signaling molecules and interaction    04081 Hormone signaling     100704156  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100704156   09143 Cell growth and death    04114 Oocyte meiosis     100704156   09142 Cell motility    04810 Regulation of actin cytoskeleton     100704156  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100704156    04914 Progesterone-mediated oocyte maturation     100704156  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:onl04052]     100704156 Cytokines and neuropeptides [BR:onl04052]  Neuropeptides   Unclassified    100704156 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin CoA_binding_3 Motif Other DBs NCBI-GeneID:  100704156 NCBI-ProteinID:  XP_003445871 Ensembl:  ENSONIG00000017585 UniProt:  I3KM26 LinkDB All DBs Position LG2:complement(30359303..30361882) Genome browser AA seq 111 aa AA seqDB search MARVSWAVSMLLLLMLCSPGGSSVPLKHLCGSHLVDALYFVCGERGFFYNPSRTHKRDVE HLLGFLSKRARQDQRLWRALSGRDEPKVKRGIVEQCCHKPCSIYHLEGYCD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtatcatgggcggtgtccatgctgttactgctgatgctctgctctccaggg gggtcttcggtccccctcaagcatctgtgtggttcccacctggtggacgccctctacttt gtgtgtggagaaaggggctttttctacaatccgagccggacccacaagcgggatgtggaa catctgctcgggttcctgtctaaaagggccagacaggaccagcgactgtggagggctttg tcgggccgcgacgagcccaaagtgaagagagggatcgtggagcagtgctgccacaagccg tgcagcatttaccacctggagggctactgcgactga

DBGET integrated database retrieval system