Oreochromis niloticus (Nile tilapia): 100704979 Help Entry 100704979         CDS       T06104                                  Name (RefSeq) protein S100-P   KO K17274   protein S100-A10 Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04382   Cornified envelope formation onl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:onl00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100704979  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100704979  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:onl04147]     100704979 Exosome [BR:onl04147]  Exosomal proteins   Exosomal proteins of microglial cells    100704979 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 SPARC_Ca_bdg DEK_C Motif Other DBs NCBI-GeneID:  100704979 NCBI-ProteinID:  XP_003450937 Ensembl:  ENSONIG00000006321 UniProt:  I3JGI1 LinkDB All DBs Position LG11:21130251..21131597 Genome browser AA seq 96 aa AA seqDB search MTDLEKSMESMITVFNKYAHDGKHGKALTKKELRKLIEAELPNFLKTQKNPNTVDHIMKD LDQNKDDVLDFEEFMPFIAGLTMACEKYCSMSAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgactgacttggagaaatctatggagtccatgataaccgtgttcaacaagtatgcccat gatggcaaacatggaaaggccttaacaaagaaagaactaagaaaactaattgaggctgag cttcccaacttcctgaaaacgcagaagaatcccaacaccgtggaccatatcatgaaggat ctggaccagaacaaagatgatgtcttggactttgaagaatttatgccattcatcgccggc ctcacaatggcctgtgaaaaatattgctccatgagtgctaaaaagaagtga

DBGET integrated database retrieval system