Oreochromis niloticus (Nile tilapia): 100705970 Help Entry 100705970         CDS       T06104                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04814   Motor proteins onl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:onl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100705970  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100705970  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:onl03037]     100705970    04812 Cytoskeleton proteins [BR:onl04812]     100705970 Cilium and associated proteins [BR:onl03037]  Motile cilia and associated proteins   Dynein arm    100705970 Cytoskeleton proteins [BR:onl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100705970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  100705970 NCBI-ProteinID:  XP_003454731 LinkDB All DBs Position LG23:23468399..23470887 Genome browser AA seq 118 aa AA seqDB search MTGGMEEFHNGSEGSFNAEEADTIVKECIENVVGGGDYSQSQVNKWTASIVERCLTQLVK QGKPYKYIVTCAVMQKTGAGLHTANSCYWDTAMDGSCTVRWENRTMYCVVSVFAVATA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgacaggaggaatggaggaatttcataacggaagcgagggctcattcaatgcagaagaa gctgacaccatagtcaaagagtgcattgagaacgtcgtgggcggcggagactacagccag agtcaggtgaacaagtggacggcaagcatcgtggagcgctgcctcacgcagctcgtcaaa caggggaagccgtacaagtacattgtgacgtgtgctgtgatgcagaaaacaggtgccggc ctccacacagccaactcctgctactgggacactgccatggacgggagctgcacggtgagg tgggaaaaccgcaccatgtactgtgtggtcagcgtgttcgccgtggccactgcgtag

DBGET integrated database retrieval system