Oreochromis niloticus (Nile tilapia): 100708458 Help Entry 100708458         CDS       T06104                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04814   Motor proteins onl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:onl00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100708458 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100708458 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:onl03037]     100708458 (dynlt3)    04812 Cytoskeleton proteins [BR:onl04812]     100708458 (dynlt3) Cilium and associated proteins [BR:onl03037]  Motile cilia and associated proteins   Dynein arm    100708458 (dynlt3) Cytoskeleton proteins [BR:onl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100708458 (dynlt3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  100708458 NCBI-ProteinID:  XP_003452928 LinkDB All DBs Position LG16:complement(20602307..20607432) Genome browser AA seq 115 aa AA seqDB search MEEFNSGEEVVFNPDEISVSVKECVEGVIGGTDYNQSKVNQWTASIVEHSLTHLVKQGRP FKYIVNCTIMQKSGAGLHTANSCYWDTATDGSCTVRWENRTMYCVVSVFAVAVAL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtttaactctggagaagaggtcgtctttaatcccgatgagattagtgtctcg gtaaaagagtgcgttgaaggcgtcatcggtggaacagattataaccagagtaaagtcaac cagtggacggccagtatagtggagcattcactcactcacctggtgaaacaagggcggccg ttcaaatacatagtgaactgtaccatcatgcagaagagcggcgctgggctccacacagcc aactcctgctactgggacacggccactgacgggagctgtactgtcaggtgggagaaccgc accatgtactgtgtggtcagtgtgtttgctgtagctgtggcgctgtga

DBGET integrated database retrieval system