Oreochromis niloticus (Nile tilapia): 109200872 Help Entry 109200872         CDS       T06104                                  Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism onl  Oreochromis niloticus (Nile tilapia) Brite KEGG Orthology (KO) [BR:onl00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:onl01002]     109200872   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:onl04147]     109200872 Peptidases and inhibitors [BR:onl01002]  Peptidase inhibitors   Family I25: cystatin family    109200872 Exosome [BR:onl04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109200872 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Motif Other DBs NCBI-GeneID:  109200872 NCBI-ProteinID:  XP_019211981 Ensembl:  ENSONIG00000041717 UniProt:  A0A669DCZ7 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MDAIKCGGFSKVKDADEEIQTICDEVKCQVEEKRNEAYAVFKAVQYKSQVVQGINYDIKV HVGGSSYLHLRVWKKLPCYGGEAVVTGVEDHHDKDPIQPF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggatgccataaaatgtggaggattctcgaaggtgaaagacgctgatgaggaaattcag acaatctgtgatgaggttaagtgtcaagtagaggaaaaaagaaatgaagcatatgccgtg ttcaaagctgttcagtacaagagtcaagtggtgcaaggaatcaactatgacatcaaggtt catgtgggaggatccagctaccttcatctgcgggtctggaagaagcttccatgttatgga ggagaagccgtagttactggtgtggaagaccatcatgacaaagatcccatccagcctttt taa

DBGET integrated database retrieval system