Oreochromis niloticus (Nile tilapia): 109202211 Help Entry 109202211         CDS       T06104                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism onl  Oreochromis niloticus (Nile tilapia) Pathway onl04137   Mitophagy - animal onl04140   Autophagy - animal onl04144   Endocytosis onl04145   Phagosome onl04148   Efferocytosis onl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:onl00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109202211    04145 Phagosome     109202211    04140 Autophagy - animal     109202211    04137 Mitophagy - animal     109202211    04148 Efferocytosis     109202211  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109202211  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:onl04131]     109202211   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:onl04147]     109202211    04031 GTP-binding proteins [BR:onl04031]     109202211 Membrane trafficking [BR:onl04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109202211 Exosome [BR:onl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109202211   Exosomal proteins of other body fluids (saliva and urine)    109202211   Exosomal proteins of colorectal cancer cells    109202211   Exosomal proteins of bladder cancer cells    109202211 GTP-binding proteins [BR:onl04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109202211 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA RsgA_GTPase MMR_HSR1 GTP_EFTU ATP_bind_1 AAA_5 G-alpha nSTAND3 PduV-EutP AAA_16 AAA_24 AAA_7 ABC_tran cobW DAP3 AAA NACHT NTPase_1 DUF4998 AAA_22 Motif Other DBs NCBI-GeneID:  109202211 NCBI-ProteinID:  XP_019214460 LinkDB All DBs Position LG5:complement(22872521..22877565) Genome browser AA seq 210 aa AA seqDB search MPSKKKSLLKVILLGDSGVGKTSLMNQYAIKTFSNQYKATIGADFLTKEVMVDDRVVVLQ IWDTAGQERFQSVNVTYYRGADCCVLVFDVTAPDTFKSLDSWMDHFLIEGYPRHPEDFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKDATNLEQAFQTIVHNALKQASQG TDVELYHDFPESIVLGENDESESSAKRCSC NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccatccaagaagaaatcgcttctgaaagtcatcctcctgggagattcaggtgttggg aagacctccttaatgaaccagtatgccatcaagacatttagtaaccagtacaaagccaca ataggagcagacttcctgacgaaggaggtgatggttgacgaccgggttgttgtattgcag atctgggacacagctggccaggagaggttccagtctgtgaatgttacatactatcgtgga gcagactgctgtgtgctggtttttgatgttactgcacccgatacattcaaatcacttgac agctggatggaccattttctgattgagggctaccctcgacatcctgaggacttcccattt gtggtgctaggcaacaagattgacttggaaaacagacaggtgaccaccaaaagggctcag gcctggtgccaaagtaagaacaacatcccctactttgagaccagtgcaaaagacgccaca aatctagaacaggcattccagacaattgtacataacgcactcaaacaggcctcacagggg acagatgtggagttgtatcatgacttcccagagtccatagtattaggagagaatgatgaa tctgagtcttcagcaaaaagatgcagctgctaa

DBGET integrated database retrieval system