Orcinus orca (killer whale): 101269878 Help Entry 101269878         CDS       T05247                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism oor  Orcinus orca (killer whale) Pathway oor04066   HIF-1 signaling pathway oor04120   Ubiquitin mediated proteolysis oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:oor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101269878 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     101269878 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101269878 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     101269878 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101269878 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oor04121]     101269878 (ELOB)    03400 DNA repair and recombination proteins [BR:oor03400]     101269878 (ELOB) Ubiquitin system [BR:oor04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101269878 (ELOB)    Cul5 complex      101269878 (ELOB) DNA repair and recombination proteins [BR:oor03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101269878 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  101269878 NCBI-ProteinID:  XP_004270326 LinkDB All DBs Position 16:51780061..51784684 Genome browser AA seq 158 aa AA seqDB search MAVMGRGRQARGTLGTARGLPGTGRSAAAPARRGGEAAAAMDVFLMIRRHKTTIFTDAKE SSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR ADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atggcggtcatggggcggggccgccaggcgcggggtacgctgggaacagcgcgcgggctg ccgggaacggggcggagcgcggccgcgccggcgcgtcgagggggagaggcagccgccgcg atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcactgtgttcgagctaaagcgcatcgtcgagggcatcctcaagcggccgccggac gagcagcggctgtacaaggacgaccagcttctggacgacggaaagacattgggcgagtgt ggcttcaccagccagacagcacggcctcaggccccagccactgtggggctagccttcagg gcagatgaggcctttgaggccctgcgcatcgagcccttctccagcccacccgagctgccg gatgtgatgaagccacaggactcaggaagcagcgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system