Orcinus orca (killer whale): 101270123 Help Entry 101270123         CDS       T05247                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04061   Viral protein interaction with cytokine and cytokine receptor oor04064   NF-kappa B signaling pathway oor04668   TNF signaling pathway oor04940   Type I diabetes mellitus oor05166   Human T-cell leukemia virus 1 infection oor05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101270123 (LTA)    04668 TNF signaling pathway     101270123 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101270123 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     101270123 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101270123 (LTA)    05168 Herpes simplex virus 1 infection     101270123 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101270123 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101270123 (LTA) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Tumor necrosis fators    101270123 (LTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  101270123 NCBI-ProteinID:  XP_004286659 LinkDB All DBs Position 10:complement(82786288..82790725) Genome browser AA seq 205 aa AA seqDB search MTPPGRLYLLRVCSTPLLLLLLGLLLALPPEAQGLSGVGLPPSTAQPAHQHPPNHFTRGT FKPAAHLVGDPSTQDSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGEGC FPKATPTPLYLAHEVQLFSSQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTRGDQ LSTHTDGISHLLLSPSSVFFGAFAL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacaccacctggacgtctctacctcctgagggtgtgcagcacccccctactcctcctc cttctgggactgctgctggccctgccgcccgaggcccaggggctctctggtgttggcctc ccaccctcaactgcacagcctgcccatcagcaccccccgaatcacttcacccgaggcacc ttcaaacctgctgctcaccttgttggagaccccagcacccaggactcactgcgctggaga gcgaacacggatcgcgccttcctccgccacggcttctctctgagcaacaattccctcctg gtccccaccagtggcctctacttcgtctactcccaggtggtcttctctggggaaggctgc ttccccaaggccacccccacccctctctacctggcccacgaggtccagctcttctcctcc cagtacccattccacgtgcctctcctcagcgctcagaagtccgtgtgcccagggccacag ggaccttgggtgcgctcggtgtaccagggggctgtgttcctgctcacccggggagaccag ctatccactcacacagatggcatctcccacctgctcctcagccccagtagcgtcttcttc ggagccttcgctctatag

DBGET integrated database retrieval system