Orcinus orca (killer whale): 101271012 Help Entry 101271012         CDS       T05247                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism oor  Orcinus orca (killer whale) Pathway oor04510   Focal adhesion oor04520   Adherens junction oor04670   Leukocyte transendothelial migration oor04810   Regulation of actin cytoskeleton oor04814   Motor proteins oor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oor00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101271012 (MYL10)    04520 Adherens junction     101271012 (MYL10)   09142 Cell motility    04814 Motor proteins     101271012 (MYL10)    04810 Regulation of actin cytoskeleton     101271012 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101271012 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101271012 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oor04812]     101271012 (MYL10) Cytoskeleton proteins [BR:oor04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      101271012 (MYL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C EF-hand_FSTL1 AIF-1 Motif Other DBs NCBI-GeneID:  101271012 NCBI-ProteinID:  XP_004268884 LinkDB All DBs Position 16:80383258..80391927 Genome browser AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFNVFDTEGKGFVKADFIKEKLMTQADRFSEDEIKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcagtcccagatccaggagtttaaagaggctttcaccatcatggaccagaac cgggatggcttcatcgacaaggaggacctgagggacacctttgctgccctgggccgcatc aacgtaaagaacgaggagctggaggccatggtgaaggaggcccccgggcccatcaacttc accgtcttcctgaccatgtttggggagaagctgaagggtacggacccggaggagaccatt ctccacgccttcaatgtgttcgacactgaagggaaaggtttcgtcaaggctgatttcatc aaagagaagctcatgacgcaggcagaccgcttcagtgaggacgagatcaagcagatgttt gctgccttcccgccagatgtgtgtggcaatctggactataggaacctgtgttacgtcatc acgcatggcgaagagaaggactaa

DBGET integrated database retrieval system