Orcinus orca (killer whale): 101272616 Help Entry 101272616         CDS       T05247                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha isoform X1   KO K04383   interleukin 1 alpha Organism oor  Orcinus orca (killer whale) Pathway oor04010   MAPK signaling pathway oor04060   Cytokine-cytokine receptor interaction oor04217   Necroptosis oor04218   Cellular senescence oor04380   Osteoclast differentiation oor04640   Hematopoietic cell lineage oor04932   Non-alcoholic fatty liver disease oor04933   AGE-RAGE signaling pathway in diabetic complications oor04940   Type I diabetes mellitus oor05010   Alzheimer disease oor05020   Prion disease oor05022   Pathways of neurodegeneration - multiple diseases oor05133   Pertussis oor05140   Leishmaniasis oor05152   Tuberculosis oor05162   Measles oor05164   Influenza A oor05321   Inflammatory bowel disease oor05323   Rheumatoid arthritis oor05332   Graft-versus-host disease oor05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101272616 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101272616 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101272616 (IL1A)    04218 Cellular senescence     101272616 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101272616 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     101272616 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101272616 (IL1A)    05162 Measles     101272616 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     101272616 (IL1A)    05152 Tuberculosis     101272616 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101272616 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     101272616 (IL1A)    05321 Inflammatory bowel disease     101272616 (IL1A)    05332 Graft-versus-host disease     101272616 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     101272616 (IL1A)    05020 Prion disease     101272616 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     101272616 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101272616 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101272616 (IL1A)    04932 Non-alcoholic fatty liver disease     101272616 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     101272616 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101272616 (IL1A) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interleukins    101272616 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  101272616 NCBI-ProteinID:  XP_004276814 LinkDB All DBs Position 13:complement(11925883..11937688) Genome browser AA seq 265 aa AA seqDB search MAKVPDLFEDLKNCYSENEAYSSEIDHLSLNQKSFYDTSYEPLRQDCIDKYMSLNTPETS KTSKLTFKENVMMVAANGKILKNRWLSLNQFLTDDDLEDIADDTEEEIIKPRSAHYSFQS NMKYNFIKLIQQQYILNDALHQSIVLHPSGQYLMAAALNNLDEAVEFDIAAYTSGDDTQL PVTLRISKTQLFVCAQNEGEPVLLKEMPETPQTIKDETDLLFLWSNHGSMQHFKSVAHPK LYFATKGEKLVHLARGPPSIIDFQL NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccccgacctctttgaagacctgaagaactgttacagtgaaaatgaagca tacagttccgaaattgaccatctgtctctgaatcagaagtccttctatgatacaagctat gaaccacttcgtcaggactgcatagataaatatatgtctctgaatacccctgaaacctct aagacatccaagcttaccttcaaggaaaatgtgatgatggtggcagccaacgggaagatt ctgaagaacagatggttgagtttaaatcagttcctcaccgacgatgacctggaagacatt gccgatgatacagaagaagaaatcatcaagcccagatcagcacattacagcttccagagc aacatgaaatacaactttatcaagctcatccaacagcaatacatcctgaatgacgccctc catcaaagtatagttctacatccgtcaggtcaatacctcatggctgctgcattaaataat ctggatgaggcagtggaatttgacatagctgcttatacatcaggagatgatactcaactt cctgtgactctaagaatctcaaaaactcaactgtttgtttgtgctcaaaacgaaggcgaa cccgtattgctaaaggagatgcctgagacaccccaaaccatcaaagatgagaccgatctc ctcttcctctggagcaaccatggcagtatgcaacacttcaaatcagttgcccatcccaag ctgtattttgccacaaagggagaaaaactggtgcacctggcaaggggcccgccctctatc attgactttcagctttga

DBGET integrated database retrieval system