Orcinus orca (killer whale): 101274648 Help Entry 101274648         CDS       T05247                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04061   Viral protein interaction with cytokine and cytokine receptor oor04151   PI3K-Akt signaling pathway oor04625   C-type lectin receptor signaling pathway oor04630   JAK-STAT signaling pathway oor04658   Th1 and Th2 cell differentiation oor04659   Th17 cell differentiation oor04660   T cell receptor signaling pathway oor04672   Intestinal immune network for IgA production oor04940   Type I diabetes mellitus oor05135   Yersinia infection oor05142   Chagas disease oor05162   Measles oor05166   Human T-cell leukemia virus 1 infection oor05171   Coronavirus disease oor05200   Pathways in cancer oor05320   Autoimmune thyroid disease oor05321   Inflammatory bowel disease oor05330   Allograft rejection oor05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101274648 (IL2)    04151 PI3K-Akt signaling pathway     101274648 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101274648 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     101274648 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101274648 (IL2)    04660 T cell receptor signaling pathway     101274648 (IL2)    04658 Th1 and Th2 cell differentiation     101274648 (IL2)    04659 Th17 cell differentiation     101274648 (IL2)    04672 Intestinal immune network for IgA production     101274648 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101274648 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101274648 (IL2)    05171 Coronavirus disease     101274648 (IL2)    05162 Measles     101274648 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     101274648 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     101274648 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     101274648 (IL2)    05321 Inflammatory bowel disease     101274648 (IL2)    05330 Allograft rejection     101274648 (IL2)    05332 Graft-versus-host disease     101274648 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101274648 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101274648 (IL2)    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101274648 (IL2) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interleukins    101274648 (IL2) Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Cytokines    101274648 (IL2) SSDB OrthologParalogGFIT Motif Pfam:  IL2 DISC1 Motif Other DBs NCBI-GeneID:  101274648 NCBI-ProteinID:  XP_004265151 LinkDB All DBs Position 4:complement(135806541..135811799) Genome browser AA seq 154 aa AA seqDB search MYKMQLLSCIALTLALVANGAPTSSSTENTKKQVQSLLQDLHLLLKEINNYENLKLFRML TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS ETRFTCEYDDETVTAVELLNKWITFCQSIYSTMT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatgcaactcttgtcttgcattgcactaactcttgcactcgtggcaaacggt gcacctacttcaagctctacagagaacacaaagaaacaagtgcagtcattgctgcaggat ttacatttgcttttgaaggaaattaataactatgagaacctcaagctcttcaggatgctc acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactcg atagatatcaaggatttaatggacaatatcaacagaatagttttgacactaaagggatct gaaacaagattcacatgtgaatatgatgatgagacagtaaccgctgtagaacttctgaac aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system