Orcinus orca (killer whale): 101274883 Help Entry 101274883         CDS       T05247                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism oor  Orcinus orca (killer whale) Pathway oor04081   Hormone signaling oor04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     101274883 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     101274883 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101274883 (GAST) Cytokines and neuropeptides [BR:oor04052]  Neuropeptides   GPCR binding    101274883 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin PsbT Motif Other DBs NCBI-GeneID:  101274883 NCBI-ProteinID:  XP_004282835 LinkDB All DBs Position 19:complement(41313309..41313851) Genome browser AA seq 104 aa AA seqDB search MQRLCAYVLILVLALATFSEASWKPRSHLQDAPLGPGASRGQEPHGLDQLGPASHHRRQL GLQDPSHLVADLSKKQGPWVEEEEEAYGWMDFGRRSAEEGDLGP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcgtatgtgctgatcttggtgctggctctggccaccttctctgaa gcttcttggaagccccgctcccacctgcaggatgcacccttgggtcccggggccagtagg ggccaggagccacatgggctggaccagttgggcccagcctctcaccaccgaaggcagctg gggctccaggatccctcacacttggtagcagacctgtccaagaagcaaggaccatgggtg gaagaagaagaagaagcatatggctggatggacttcggccgccgcagtgccgaggaaggg gacctaggtccctag

DBGET integrated database retrieval system