Orcinus orca (killer whale): 101274883 Help Entry 101274883         CDS       T05247                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism oor  Orcinus orca (killer whale) Pathway oor04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:oor00001]  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     101274883 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101274883 (GAST) Cytokines and neuropeptides [BR:oor04052]  Neuropeptides   Neuropeptides (GPCR binding)    101274883 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin PsbT Motif Other DBs NCBI-GeneID:  101274883 NCBI-ProteinID:  XP_004282835 LinkDB All DBs Position 19:complement(41313309..41313851) Genome browser AA seq 104 aa AA seqDB search MQRLCAYVLILVLALATFSEASWKPRSHLQDAPLGPGASRGQEPHGLDQLGPASHHRRQL GLQDPSHLVADLSKKQGPWVEEEEEAYGWMDFGRRSAEEGDLGP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcgtatgtgctgatcttggtgctggctctggccaccttctctgaa gcttcttggaagccccgctcccacctgcaggatgcacccttgggtcccggggccagtagg ggccaggagccacatgggctggaccagttgggcccagcctctcaccaccgaaggcagctg gggctccaggatccctcacacttggtagcagacctgtccaagaagcaaggaccatgggtg gaagaagaagaagaagcatatggctggatggacttcggccgccgcagtgccgaggaaggg gacctaggtccctag

DBGET integrated database retrieval system