Orcinus orca (killer whale): 101275275 Help Entry 101275275         CDS       T05247                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04151   PI3K-Akt signaling pathway oor04217   Necroptosis oor04620   Toll-like receptor signaling pathway oor04621   NOD-like receptor signaling pathway oor04622   RIG-I-like receptor signaling pathway oor04623   Cytosolic DNA-sensing pathway oor04630   JAK-STAT signaling pathway oor04650   Natural killer cell mediated cytotoxicity oor04936   Alcoholic liver disease oor05152   Tuberculosis oor05160   Hepatitis C oor05161   Hepatitis B oor05162   Measles oor05163   Human cytomegalovirus infection oor05164   Influenza A oor05165   Human papillomavirus infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05168   Herpes simplex virus 1 infection oor05169   Epstein-Barr virus infection oor05170   Human immunodeficiency virus 1 infection oor05171   Coronavirus disease - COVID-19 oor05200   Pathways in cancer oor05320   Autoimmune thyroid disease oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101275275    04151 PI3K-Akt signaling pathway     101275275   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101275275  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101275275  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101275275    04621 NOD-like receptor signaling pathway     101275275    04622 RIG-I-like receptor signaling pathway     101275275    04623 Cytosolic DNA-sensing pathway     101275275    04650 Natural killer cell mediated cytotoxicity     101275275  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101275275   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101275275    05161 Hepatitis B     101275275    05160 Hepatitis C     101275275    05171 Coronavirus disease - COVID-19     101275275    05164 Influenza A     101275275    05162 Measles     101275275    05168 Herpes simplex virus 1 infection     101275275    05163 Human cytomegalovirus infection     101275275    05167 Kaposi sarcoma-associated herpesvirus infection     101275275    05169 Epstein-Barr virus infection     101275275    05165 Human papillomavirus infection     101275275   09171 Infectious disease: bacterial    05152 Tuberculosis     101275275   09163 Immune disease    05320 Autoimmune thyroid disease     101275275   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101275275   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101275275  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101275275 Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interferons    101275275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  101275275 NCBI-ProteinID:  XP_004275091 LinkDB All DBs Position 6:complement(50714150..50714719) Genome browser AA seq 189 aa AA seqDB search MAPTLSLLLALVLLSCNSNCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG FPQEAFGGNQFQKAQAIAVVHEMIQQTFQLFSTEGSAAAWDETLLDKFCTALYQQLTDLQ ACLMQEAGLEGTPLPKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccaactttgtccttactcctggccctggtgctgctcagctgcaactccaactgc tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc ctgcaacagatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggaggcgtttggaggcaaccagttccagaaggctcaagccatcgctgtcgtc catgagatgatccagcagaccttccagctcttcagcacagagggctcggctgccgcttgg gatgagaccctcctggacaagttctgcaccgcactttatcagcagctcactgacctgcaa gcctgtctgatgcaggaggcggggctggaagggactcccctgccgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaagtacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac ttgcaagaaagactcaggaggaaggaatga

DBGET integrated database retrieval system