KEGG   Orcinus orca (killer whale): 101276138
Entry
101276138         CDS       T05247                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04625  C-type lectin receptor signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05207  Chemical carcinogenesis - receptor activation
oor05208  Chemical carcinogenesis - reactive oxygen species
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101276138 (NRAS)
   04012 ErbB signaling pathway
    101276138 (NRAS)
   04014 Ras signaling pathway
    101276138 (NRAS)
   04015 Rap1 signaling pathway
    101276138 (NRAS)
   04370 VEGF signaling pathway
    101276138 (NRAS)
   04371 Apelin signaling pathway
    101276138 (NRAS)
   04068 FoxO signaling pathway
    101276138 (NRAS)
   04072 Phospholipase D signaling pathway
    101276138 (NRAS)
   04071 Sphingolipid signaling pathway
    101276138 (NRAS)
   04151 PI3K-Akt signaling pathway
    101276138 (NRAS)
   04150 mTOR signaling pathway
    101276138 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101276138 (NRAS)
   04137 Mitophagy - animal
    101276138 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101276138 (NRAS)
   04218 Cellular senescence
    101276138 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101276138 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101276138 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101276138 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101276138 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    101276138 (NRAS)
   04660 T cell receptor signaling pathway
    101276138 (NRAS)
   04662 B cell receptor signaling pathway
    101276138 (NRAS)
   04664 Fc epsilon RI signaling pathway
    101276138 (NRAS)
   04062 Chemokine signaling pathway
    101276138 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101276138 (NRAS)
   04929 GnRH secretion
    101276138 (NRAS)
   04912 GnRH signaling pathway
    101276138 (NRAS)
   04915 Estrogen signaling pathway
    101276138 (NRAS)
   04917 Prolactin signaling pathway
    101276138 (NRAS)
   04921 Oxytocin signaling pathway
    101276138 (NRAS)
   04926 Relaxin signaling pathway
    101276138 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    101276138 (NRAS)
   04919 Thyroid hormone signaling pathway
    101276138 (NRAS)
   04916 Melanogenesis
    101276138 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101276138 (NRAS)
   04726 Serotonergic synapse
    101276138 (NRAS)
   04720 Long-term potentiation
    101276138 (NRAS)
   04730 Long-term depression
    101276138 (NRAS)
   04722 Neurotrophin signaling pathway
    101276138 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101276138 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101276138 (NRAS)
   04213 Longevity regulating pathway - multiple species
    101276138 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101276138 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101276138 (NRAS)
   05206 MicroRNAs in cancer
    101276138 (NRAS)
   05205 Proteoglycans in cancer
    101276138 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    101276138 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    101276138 (NRAS)
   05203 Viral carcinogenesis
    101276138 (NRAS)
   05230 Central carbon metabolism in cancer
    101276138 (NRAS)
   05231 Choline metabolism in cancer
    101276138 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101276138 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101276138 (NRAS)
   05225 Hepatocellular carcinoma
    101276138 (NRAS)
   05226 Gastric cancer
    101276138 (NRAS)
   05214 Glioma
    101276138 (NRAS)
   05216 Thyroid cancer
    101276138 (NRAS)
   05221 Acute myeloid leukemia
    101276138 (NRAS)
   05220 Chronic myeloid leukemia
    101276138 (NRAS)
   05218 Melanoma
    101276138 (NRAS)
   05211 Renal cell carcinoma
    101276138 (NRAS)
   05219 Bladder cancer
    101276138 (NRAS)
   05215 Prostate cancer
    101276138 (NRAS)
   05213 Endometrial cancer
    101276138 (NRAS)
   05224 Breast cancer
    101276138 (NRAS)
   05223 Non-small cell lung cancer
    101276138 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101276138 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    101276138 (NRAS)
   05161 Hepatitis B
    101276138 (NRAS)
   05160 Hepatitis C
    101276138 (NRAS)
   05163 Human cytomegalovirus infection
    101276138 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101276138 (NRAS)
   05165 Human papillomavirus infection
    101276138 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101276138 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101276138 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    101276138 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101276138 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101276138 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101276138 (NRAS)
   01522 Endocrine resistance
    101276138 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101276138 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101276138 (NRAS)
   04031 GTP-binding proteins [BR:oor04031]
    101276138 (NRAS)
Membrane trafficking [BR:oor04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    101276138 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101276138 (NRAS)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101276138 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   101276138 (NRAS)
  Exosomal proteins of breast cancer cells
   101276138 (NRAS)
  Exosomal proteins of colorectal cancer cells
   101276138 (NRAS)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101276138 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 101276138
NCBI-ProteinID: XP_004263275
LinkDB
Position
1:111784488..111800806
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtagtgatgtaa

DBGET integrated database retrieval system