Orcinus orca (killer whale): 101276138 Help Entry 101276138         CDS       T05247                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor01522   Endocrine resistance oor04010   MAPK signaling pathway oor04012   ErbB signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04062   Chemokine signaling pathway oor04068   FoxO signaling pathway oor04071   Sphingolipid signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04150   mTOR signaling pathway oor04151   PI3K-Akt signaling pathway oor04210   Apoptosis oor04211   Longevity regulating pathway oor04213   Longevity regulating pathway - multiple species oor04218   Cellular senescence oor04360   Axon guidance oor04370   VEGF signaling pathway oor04371   Apelin signaling pathway oor04540   Gap junction oor04550   Signaling pathways regulating pluripotency of stem cells oor04625   C-type lectin receptor signaling pathway oor04650   Natural killer cell mediated cytotoxicity oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04664   Fc epsilon RI signaling pathway oor04714   Thermogenesis oor04720   Long-term potentiation oor04722   Neurotrophin signaling pathway oor04725   Cholinergic synapse oor04726   Serotonergic synapse oor04730   Long-term depression oor04810   Regulation of actin cytoskeleton oor04910   Insulin signaling pathway oor04912   GnRH signaling pathway oor04915   Estrogen signaling pathway oor04916   Melanogenesis oor04917   Prolactin signaling pathway oor04919   Thyroid hormone signaling pathway oor04921   Oxytocin signaling pathway oor04926   Relaxin signaling pathway oor04929   GnRH secretion oor04933   AGE-RAGE signaling pathway in diabetic complications oor04935   Growth hormone synthesis, secretion and action oor05010   Alzheimer disease oor05022   Pathways of neurodegeneration - multiple diseases oor05034   Alcoholism oor05160   Hepatitis C oor05161   Hepatitis B oor05163   Human cytomegalovirus infection oor05165   Human papillomavirus infection oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05203   Viral carcinogenesis oor05205   Proteoglycans in cancer oor05206   MicroRNAs in cancer oor05207   Chemical carcinogenesis - receptor activation oor05208   Chemical carcinogenesis - reactive oxygen species oor05210   Colorectal cancer oor05211   Renal cell carcinoma oor05213   Endometrial cancer oor05214   Glioma oor05215   Prostate cancer oor05216   Thyroid cancer oor05218   Melanoma oor05219   Bladder cancer oor05220   Chronic myeloid leukemia oor05221   Acute myeloid leukemia oor05223   Non-small cell lung cancer oor05224   Breast cancer oor05225   Hepatocellular carcinoma oor05226   Gastric cancer oor05230   Central carbon metabolism in cancer oor05231   Choline metabolism in cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101276138 (NRAS)    04012 ErbB signaling pathway     101276138 (NRAS)    04014 Ras signaling pathway     101276138 (NRAS)    04015 Rap1 signaling pathway     101276138 (NRAS)    04370 VEGF signaling pathway     101276138 (NRAS)    04371 Apelin signaling pathway     101276138 (NRAS)    04068 FoxO signaling pathway     101276138 (NRAS)    04072 Phospholipase D signaling pathway     101276138 (NRAS)    04071 Sphingolipid signaling pathway     101276138 (NRAS)    04151 PI3K-Akt signaling pathway     101276138 (NRAS)    04150 mTOR signaling pathway     101276138 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101276138 (NRAS)    04137 Mitophagy - animal     101276138 (NRAS)   09143 Cell growth and death    04210 Apoptosis     101276138 (NRAS)    04218 Cellular senescence     101276138 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101276138 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101276138 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101276138 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101276138 (NRAS)    04650 Natural killer cell mediated cytotoxicity     101276138 (NRAS)    04660 T cell receptor signaling pathway     101276138 (NRAS)    04662 B cell receptor signaling pathway     101276138 (NRAS)    04664 Fc epsilon RI signaling pathway     101276138 (NRAS)    04062 Chemokine signaling pathway     101276138 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101276138 (NRAS)    04929 GnRH secretion     101276138 (NRAS)    04912 GnRH signaling pathway     101276138 (NRAS)    04915 Estrogen signaling pathway     101276138 (NRAS)    04917 Prolactin signaling pathway     101276138 (NRAS)    04921 Oxytocin signaling pathway     101276138 (NRAS)    04926 Relaxin signaling pathway     101276138 (NRAS)    04935 Growth hormone synthesis, secretion and action     101276138 (NRAS)    04919 Thyroid hormone signaling pathway     101276138 (NRAS)    04916 Melanogenesis     101276138 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     101276138 (NRAS)    04726 Serotonergic synapse     101276138 (NRAS)    04720 Long-term potentiation     101276138 (NRAS)    04730 Long-term depression     101276138 (NRAS)    04722 Neurotrophin signaling pathway     101276138 (NRAS)   09158 Development and regeneration    04360 Axon guidance     101276138 (NRAS)   09149 Aging    04211 Longevity regulating pathway     101276138 (NRAS)    04213 Longevity regulating pathway - multiple species     101276138 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     101276138 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101276138 (NRAS)    05206 MicroRNAs in cancer     101276138 (NRAS)    05205 Proteoglycans in cancer     101276138 (NRAS)    05207 Chemical carcinogenesis - receptor activation     101276138 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     101276138 (NRAS)    05203 Viral carcinogenesis     101276138 (NRAS)    05230 Central carbon metabolism in cancer     101276138 (NRAS)    05231 Choline metabolism in cancer     101276138 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101276138 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101276138 (NRAS)    05225 Hepatocellular carcinoma     101276138 (NRAS)    05226 Gastric cancer     101276138 (NRAS)    05214 Glioma     101276138 (NRAS)    05216 Thyroid cancer     101276138 (NRAS)    05221 Acute myeloid leukemia     101276138 (NRAS)    05220 Chronic myeloid leukemia     101276138 (NRAS)    05218 Melanoma     101276138 (NRAS)    05211 Renal cell carcinoma     101276138 (NRAS)    05219 Bladder cancer     101276138 (NRAS)    05215 Prostate cancer     101276138 (NRAS)    05213 Endometrial cancer     101276138 (NRAS)    05224 Breast cancer     101276138 (NRAS)    05223 Non-small cell lung cancer     101276138 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101276138 (NRAS)    05170 Human immunodeficiency virus 1 infection     101276138 (NRAS)    05161 Hepatitis B     101276138 (NRAS)    05160 Hepatitis C     101276138 (NRAS)    05163 Human cytomegalovirus infection     101276138 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101276138 (NRAS)    05165 Human papillomavirus infection     101276138 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101276138 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     101276138 (NRAS)   09165 Substance dependence    05034 Alcoholism     101276138 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101276138 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101276138 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101276138 (NRAS)    01522 Endocrine resistance     101276138 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     101276138 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oor04147]     101276138 (NRAS)    04031 GTP-binding proteins [BR:oor04031]     101276138 (NRAS) Membrane trafficking [BR:oor04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101276138 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101276138 (NRAS) Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101276138 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    101276138 (NRAS)   Exosomal proteins of breast cancer cells    101276138 (NRAS)   Exosomal proteins of colorectal cancer cells    101276138 (NRAS) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101276138 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  101276138 NCBI-ProteinID:  XP_004263275 LinkDB All DBs Position 1:111784488..111800806 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatgggattgccatgtgtagtgatgtaa

DBGET integrated database retrieval system