KEGG   Orcinus orca (killer whale): 101277818
Entry
101277818         CDS       T05247                                 
Symbol
ATP5MC3
Name
(RefSeq) ATP synthase F(0) complex subunit C3, mitochondrial
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00190  Oxidative phosphorylation
oor01100  Metabolic pathways
oor04714  Thermogenesis
oor05010  Alzheimer disease
oor05012  Parkinson disease
oor05014  Amyotrophic lateral sclerosis
oor05016  Huntington disease
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05208  Chemical carcinogenesis - reactive oxygen species
oor05415  Diabetic cardiomyopathy
Module
oor_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101277818 (ATP5MC3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101277818 (ATP5MC3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101277818 (ATP5MC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101277818 (ATP5MC3)
   05012 Parkinson disease
    101277818 (ATP5MC3)
   05014 Amyotrophic lateral sclerosis
    101277818 (ATP5MC3)
   05016 Huntington disease
    101277818 (ATP5MC3)
   05020 Prion disease
    101277818 (ATP5MC3)
   05022 Pathways of neurodegeneration - multiple diseases
    101277818 (ATP5MC3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101277818 (ATP5MC3)
SSDB
Motif
Pfam: ATP-synt_C TM1506 Phage_holin_3_6
Other DBs
NCBI-GeneID: 101277818
NCBI-ProteinID: XP_004267388
LinkDB
Position
7:complement(62968386..62972059)
AA seq 141 aa
MFACAKLACTPALIRAGSRVAYRPISASVLSRPEARTGESSMVFNGAQNGVSQLIQREFQ
TSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt   +upstreamnt  +downstreamnt
atgttcgcctgcgccaagctcgcctgcaccccagctctgatccgagctggatccagagtt
gcatacagaccaatttctgcatcagtgttatctcgaccagaggctaggactggagagagc
tctatggtatttaatggggcccagaatggtgtgtctcagttaatccaaagggagttccag
accagtgcagtcagcagagacattgatactgcggccaaatttataggtgcaggtgctgca
acagtaggagtggctggttctggtgctggtattggcacagtcttcggcagcctcatcatt
ggttacgccagaaacccttcgctgaaacagcagctgttctcatatgctatcctgggattt
gccttgtctgaagctatgggtctcttttgtttgatggttgctttcttgattttgtttgcc
atgtaa

DBGET integrated database retrieval system