Orcinus orca (killer whale): 101278494 Help Entry 101278494         CDS       T05247                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism oor  Orcinus orca (killer whale) Pathway oor04010   MAPK signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04022   cGMP-PKG signaling pathway oor04066   HIF-1 signaling pathway oor04068   FoxO signaling pathway oor04072   Phospholipase D signaling pathway oor04081   Hormone signaling oor04114   Oocyte meiosis oor04140   Autophagy - animal oor04150   mTOR signaling pathway oor04151   PI3K-Akt signaling pathway oor04152   AMPK signaling pathway oor04211   Longevity regulating pathway oor04213   Longevity regulating pathway - multiple species oor04810   Regulation of actin cytoskeleton oor04910   Insulin signaling pathway oor04911   Insulin secretion oor04913   Ovarian steroidogenesis oor04914   Progesterone-mediated oocyte maturation oor04917   Prolactin signaling pathway oor04923   Regulation of lipolysis in adipocytes oor04930   Type II diabetes mellitus oor04931   Insulin resistance oor04932   Non-alcoholic fatty liver disease oor04940   Type I diabetes mellitus oor04950   Maturity onset diabetes of the young oor04960   Aldosterone-regulated sodium reabsorption oor05010   Alzheimer disease oor05215   Prostate cancer oor05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101278494 (INS)    04014 Ras signaling pathway     101278494 (INS)    04015 Rap1 signaling pathway     101278494 (INS)    04066 HIF-1 signaling pathway     101278494 (INS)    04068 FoxO signaling pathway     101278494 (INS)    04072 Phospholipase D signaling pathway     101278494 (INS)    04022 cGMP-PKG signaling pathway     101278494 (INS)    04151 PI3K-Akt signaling pathway     101278494 (INS)    04152 AMPK signaling pathway     101278494 (INS)    04150 mTOR signaling pathway     101278494 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     101278494 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101278494 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     101278494 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101278494 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     101278494 (INS)    04910 Insulin signaling pathway     101278494 (INS)    04923 Regulation of lipolysis in adipocytes     101278494 (INS)    04913 Ovarian steroidogenesis     101278494 (INS)    04914 Progesterone-mediated oocyte maturation     101278494 (INS)    04917 Prolactin signaling pathway     101278494 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     101278494 (INS)   09149 Aging    04211 Longevity regulating pathway     101278494 (INS)    04213 Longevity regulating pathway - multiple species     101278494 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     101278494 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101278494 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     101278494 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     101278494 (INS)    04940 Type I diabetes mellitus     101278494 (INS)    04950 Maturity onset diabetes of the young     101278494 (INS)    04932 Non-alcoholic fatty liver disease     101278494 (INS)    04931 Insulin resistance     101278494 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101278494 (INS) Cytokines and neuropeptides [BR:oor04052]  Neuropeptides   Unclassified    101278494 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  101278494 NCBI-ProteinID:  XP_004278117 LinkDB All DBs Position 8:complement(1582442..1583522) Genome browser AA seq 110 aa AA seqDB search MVLWLRLGPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG PQVGAVELGGGPGAGGLQPPALEGPPQKRGIVEQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggtcctgtggctgcgccttgggcccctgctggccctgctggccctctgggcgcccgcc cctgcccgggccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtgtgcggggagcgtggcttcttctacacgcccaaggcccgccgggaggtggagggc ccgcaggtgggggccgtggagctgggtggaggccccggtgccggcggcctgcagcccccg gccctggaggggcccccgcagaagcgcggcatcgtggagcagtgctgcaccagcatttgt tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system