KEGG   Orcinus orca (killer whale): 101278649
Entry
101278649         CDS       T05247                                 
Symbol
CALML6
Name
(RefSeq) calmodulin-like protein 6
  KO
K02183  calmodulin
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04020  Calcium signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04371  Apelin signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04713  Circadian entrainment
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04728  Dopaminergic synapse
oor04740  Olfactory transduction
oor04744  Phototransduction
oor04750  Inflammatory mediator regulation of TRP channels
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04921  Oxytocin signaling pathway
oor04922  Glucagon signaling pathway
oor04924  Renin secretion
oor04925  Aldosterone synthesis and secretion
oor04970  Salivary secretion
oor04971  Gastric acid secretion
oor05010  Alzheimer disease
oor05012  Parkinson disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05031  Amphetamine addiction
oor05034  Alcoholism
oor05133  Pertussis
oor05152  Tuberculosis
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05214  Glioma
oor05417  Lipid and atherosclerosis
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101278649 (CALML6)
   04015 Rap1 signaling pathway
    101278649 (CALML6)
   04371 Apelin signaling pathway
    101278649 (CALML6)
   04020 Calcium signaling pathway
    101278649 (CALML6)
   04070 Phosphatidylinositol signaling system
    101278649 (CALML6)
   04024 cAMP signaling pathway
    101278649 (CALML6)
   04022 cGMP-PKG signaling pathway
    101278649 (CALML6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101278649 (CALML6)
   04218 Cellular senescence
    101278649 (CALML6)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101278649 (CALML6)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101278649 (CALML6)
   04922 Glucagon signaling pathway
    101278649 (CALML6)
   04912 GnRH signaling pathway
    101278649 (CALML6)
   04915 Estrogen signaling pathway
    101278649 (CALML6)
   04921 Oxytocin signaling pathway
    101278649 (CALML6)
   04916 Melanogenesis
    101278649 (CALML6)
   04924 Renin secretion
    101278649 (CALML6)
   04925 Aldosterone synthesis and secretion
    101278649 (CALML6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101278649 (CALML6)
   04270 Vascular smooth muscle contraction
    101278649 (CALML6)
  09154 Digestive system
   04970 Salivary secretion
    101278649 (CALML6)
   04971 Gastric acid secretion
    101278649 (CALML6)
  09156 Nervous system
   04728 Dopaminergic synapse
    101278649 (CALML6)
   04720 Long-term potentiation
    101278649 (CALML6)
   04722 Neurotrophin signaling pathway
    101278649 (CALML6)
  09157 Sensory system
   04744 Phototransduction
    101278649 (CALML6)
   04740 Olfactory transduction
    101278649 (CALML6)
   04750 Inflammatory mediator regulation of TRP channels
    101278649 (CALML6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101278649 (CALML6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101278649 (CALML6)
  09162 Cancer: specific types
   05214 Glioma
    101278649 (CALML6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101278649 (CALML6)
   05163 Human cytomegalovirus infection
    101278649 (CALML6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101278649 (CALML6)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101278649 (CALML6)
   05152 Tuberculosis
    101278649 (CALML6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101278649 (CALML6)
   05012 Parkinson disease
    101278649 (CALML6)
   05022 Pathways of neurodegeneration - multiple diseases
    101278649 (CALML6)
  09165 Substance dependence
   05031 Amphetamine addiction
    101278649 (CALML6)
   05034 Alcoholism
    101278649 (CALML6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101278649 (CALML6)
   05418 Fluid shear stress and atherosclerosis
    101278649 (CALML6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101278649 (CALML6)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101278649 (CALML6)
   03036 Chromosome and associated proteins [BR:oor03036]
    101278649 (CALML6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101278649 (CALML6)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101278649 (CALML6)
Membrane trafficking [BR:oor04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    101278649 (CALML6)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     101278649 (CALML6)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101278649 (CALML6)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 AIF-1 EF-hand_8 EF-hand_9 EH EF-hand_5 EF_EFCAB10_C EFhand_Ca_insen
Other DBs
NCBI-GeneID: 101278649
NCBI-ProteinID: XP_004272592
LinkDB
Position
1:complement(211876644..211877885)
AA seq 235 aa
MVSLPWPHWLSSAAPLHSHVAGLPLPRAPSPLSGLAEPCSPFKTHPCAAWPQACSGLGPP
ASPGLRGGGAPGEPGPMSPQTERLTAEQIEEYKGVFEMFDEEGNGAVKTDELERLMSLMG
INPTKGELASMAKDVDRDKKGFFNCDSFLALMGVYWEKAQNQESELRAAFRIFDKEGKGY
IDWDTLKYVLMNAGEPLSELEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLVQ
NT seq 708 nt   +upstreamnt  +downstreamnt
atggtgtccctcccctggcctcactggctgtccagcgctgccccactgcactctcacgtg
gctggcctgcccctgcctcgagcgccgtcccccctgagtggcctcgcggagccttgctct
cccttcaagacccatccctgtgccgcctggcctcaagcctgctctgggctggggcctcca
gcctcccctggactgaggggtggaggggctcctggcgagcctgggcccatgtccccacag
acggagcgcctgacggcggagcagatcgaggagtacaagggggtctttgagatgtttgat
gaggagggcaacggggcggtgaagacggacgagctggagcggctcatgagtctgatgggc
atcaaccccaccaagggcgagctggcctccatggccaaggacgtggacagagacaagaaa
gggttcttcaactgcgacagcttcctggcgctgatgggggtgtactgggagaaggcccag
aaccaggagagtgagctcagggcggccttccgcatcttcgacaaggagggcaagggctac
attgactgggacacgctcaagtacgtgctcatgaatgcgggcgagcccctcagcgagctg
gaggccgagcagatgatgaaggaagccgacaaggacggggacaggaccatcgactacgag
gagttcgtggccatgatgactggggagtccttcaagctggtccagtag

DBGET integrated database retrieval system