Orcinus orca (killer whale): 101278649
Help
Entry
101278649 CDS
T05247
Symbol
CALML6
Name
(RefSeq) calmodulin-like protein 6
KO
K02183
calmodulin
Organism
oor
Orcinus orca (killer whale)
Pathway
oor04014
Ras signaling pathway
oor04015
Rap1 signaling pathway
oor04020
Calcium signaling pathway
oor04022
cGMP-PKG signaling pathway
oor04024
cAMP signaling pathway
oor04070
Phosphatidylinositol signaling system
oor04114
Oocyte meiosis
oor04218
Cellular senescence
oor04261
Adrenergic signaling in cardiomyocytes
oor04270
Vascular smooth muscle contraction
oor04371
Apelin signaling pathway
oor04625
C-type lectin receptor signaling pathway
oor04713
Circadian entrainment
oor04720
Long-term potentiation
oor04722
Neurotrophin signaling pathway
oor04728
Dopaminergic synapse
oor04740
Olfactory transduction
oor04744
Phototransduction
oor04750
Inflammatory mediator regulation of TRP channels
oor04910
Insulin signaling pathway
oor04912
GnRH signaling pathway
oor04915
Estrogen signaling pathway
oor04916
Melanogenesis
oor04921
Oxytocin signaling pathway
oor04922
Glucagon signaling pathway
oor04924
Renin secretion
oor04925
Aldosterone synthesis and secretion
oor04970
Salivary secretion
oor04971
Gastric acid secretion
oor05010
Alzheimer disease
oor05012
Parkinson disease
oor05022
Pathways of neurodegeneration - multiple diseases
oor05031
Amphetamine addiction
oor05034
Alcoholism
oor05133
Pertussis
oor05152
Tuberculosis
oor05163
Human cytomegalovirus infection
oor05167
Kaposi sarcoma-associated herpesvirus infection
oor05170
Human immunodeficiency virus 1 infection
oor05200
Pathways in cancer
oor05214
Glioma
oor05417
Lipid and atherosclerosis
oor05418
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
oor00001
]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
101278649 (CALML6)
04015 Rap1 signaling pathway
101278649 (CALML6)
04371 Apelin signaling pathway
101278649 (CALML6)
04020 Calcium signaling pathway
101278649 (CALML6)
04070 Phosphatidylinositol signaling system
101278649 (CALML6)
04024 cAMP signaling pathway
101278649 (CALML6)
04022 cGMP-PKG signaling pathway
101278649 (CALML6)
09140 Cellular Processes
09143 Cell growth and death
04114 Oocyte meiosis
101278649 (CALML6)
04218 Cellular senescence
101278649 (CALML6)
09150 Organismal Systems
09151 Immune system
04625 C-type lectin receptor signaling pathway
101278649 (CALML6)
09152 Endocrine system
04910 Insulin signaling pathway
101278649 (CALML6)
04922 Glucagon signaling pathway
101278649 (CALML6)
04912 GnRH signaling pathway
101278649 (CALML6)
04915 Estrogen signaling pathway
101278649 (CALML6)
04921 Oxytocin signaling pathway
101278649 (CALML6)
04916 Melanogenesis
101278649 (CALML6)
04924 Renin secretion
101278649 (CALML6)
04925 Aldosterone synthesis and secretion
101278649 (CALML6)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
101278649 (CALML6)
04270 Vascular smooth muscle contraction
101278649 (CALML6)
09154 Digestive system
04970 Salivary secretion
101278649 (CALML6)
04971 Gastric acid secretion
101278649 (CALML6)
09156 Nervous system
04728 Dopaminergic synapse
101278649 (CALML6)
04720 Long-term potentiation
101278649 (CALML6)
04722 Neurotrophin signaling pathway
101278649 (CALML6)
09157 Sensory system
04744 Phototransduction
101278649 (CALML6)
04740 Olfactory transduction
101278649 (CALML6)
04750 Inflammatory mediator regulation of TRP channels
101278649 (CALML6)
09159 Environmental adaptation
04713 Circadian entrainment
101278649 (CALML6)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101278649 (CALML6)
09162 Cancer: specific types
05214 Glioma
101278649 (CALML6)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
101278649 (CALML6)
05163 Human cytomegalovirus infection
101278649 (CALML6)
05167 Kaposi sarcoma-associated herpesvirus infection
101278649 (CALML6)
09171 Infectious disease: bacterial
05133 Pertussis
101278649 (CALML6)
05152 Tuberculosis
101278649 (CALML6)
09164 Neurodegenerative disease
05010 Alzheimer disease
101278649 (CALML6)
05012 Parkinson disease
101278649 (CALML6)
05022 Pathways of neurodegeneration - multiple diseases
101278649 (CALML6)
09165 Substance dependence
05031 Amphetamine addiction
101278649 (CALML6)
05034 Alcoholism
101278649 (CALML6)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
101278649 (CALML6)
05418 Fluid shear stress and atherosclerosis
101278649 (CALML6)
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:
oor01009
]
101278649 (CALML6)
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
oor04131
]
101278649 (CALML6)
03036 Chromosome and associated proteins [BR:
oor03036
]
101278649 (CALML6)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
oor04147
]
101278649 (CALML6)
Protein phosphatases and associated proteins [BR:
oor01009
]
Protein serine/threonine phosphatases
Phosphoprotein phosphatases (PPPs)
Calcineurin (PPP3/ PP2B)
Regulatory subunits
101278649 (CALML6)
Membrane trafficking [BR:
oor04131
]
Exocytosis
Small GTPases and associated proteins
Rab associated proteins
101278649 (CALML6)
Chromosome and associated proteins [BR:
oor03036
]
Eukaryotic type
Centrosome formation proteins
Centrosome duplication proteins
Centriole replication proteins
101278649 (CALML6)
Exosome [BR:
oor04147
]
Exosomal proteins
Exosomal proteins of colorectal cancer cells
101278649 (CALML6)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
EF-hand_7
EF-hand_1
EF-hand_6
AIF-1
EF-hand_8
EF-hand_9
EH
EF-hand_5
EF_EFCAB10_C
EFhand_Ca_insen
Motif
Other DBs
NCBI-GeneID:
101278649
NCBI-ProteinID:
XP_004272592
LinkDB
All DBs
Position
1:complement(211876644..211877885)
Genome browser
AA seq
235 aa
AA seq
DB search
MVSLPWPHWLSSAAPLHSHVAGLPLPRAPSPLSGLAEPCSPFKTHPCAAWPQACSGLGPP
ASPGLRGGGAPGEPGPMSPQTERLTAEQIEEYKGVFEMFDEEGNGAVKTDELERLMSLMG
INPTKGELASMAKDVDRDKKGFFNCDSFLALMGVYWEKAQNQESELRAAFRIFDKEGKGY
IDWDTLKYVLMNAGEPLSELEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLVQ
NT seq
708 nt
NT seq
+upstream
nt +downstream
nt
atggtgtccctcccctggcctcactggctgtccagcgctgccccactgcactctcacgtg
gctggcctgcccctgcctcgagcgccgtcccccctgagtggcctcgcggagccttgctct
cccttcaagacccatccctgtgccgcctggcctcaagcctgctctgggctggggcctcca
gcctcccctggactgaggggtggaggggctcctggcgagcctgggcccatgtccccacag
acggagcgcctgacggcggagcagatcgaggagtacaagggggtctttgagatgtttgat
gaggagggcaacggggcggtgaagacggacgagctggagcggctcatgagtctgatgggc
atcaaccccaccaagggcgagctggcctccatggccaaggacgtggacagagacaagaaa
gggttcttcaactgcgacagcttcctggcgctgatgggggtgtactgggagaaggcccag
aaccaggagagtgagctcagggcggccttccgcatcttcgacaaggagggcaagggctac
attgactgggacacgctcaagtacgtgctcatgaatgcgggcgagcccctcagcgagctg
gaggccgagcagatgatgaaggaagccgacaaggacggggacaggaccatcgactacgag
gagttcgtggccatgatgactggggagtccttcaagctggtccagtag
DBGET
integrated database retrieval system