Orcinus orca (killer whale): 101278818 Help Entry 101278818         CDS       T05247                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism oor  Orcinus orca (killer whale) Pathway oor04613   Neutrophil extracellular trap formation oor05034   Alcoholism oor05203   Viral carcinogenesis oor05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oor00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101278818  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101278818   09163 Immune disease    05322 Systemic lupus erythematosus     101278818   09165 Substance dependence    05034 Alcoholism     101278818  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oor03036]     101278818 Chromosome and associated proteins [BR:oor03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101278818 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101278818 NCBI-ProteinID:  XP_049549655 LinkDB All DBs Position 10:85059902..85062752 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctgggcgtggtaaaggtggaaaaggcctggggaagggtggcgccaagcgccaccgc aaagttctgcgagataacatccagggcatcactaagcctgctatccgtcgcttagcccga cgtggtggcgtcaagcgtatctctggtcttatctacgaggagacccgtggggtgttgaaa gtgtttctggagaacgtgatccgggacgctgtaacctacaccgagcacgccaagcgcaag actgtcaccgccatggacgtggtctacgcgctcaagcggcagggccgcactctttatggc tttggtggctga

DBGET integrated database retrieval system