Orcinus orca (killer whale): 101279088 Help Entry 101279088         CDS       T05247                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04620   Toll-like receptor signaling pathway oor04622   RIG-I-like receptor signaling pathway oor04625   C-type lectin receptor signaling pathway oor04630   JAK-STAT signaling pathway oor04658   Th1 and Th2 cell differentiation oor04936   Alcoholic liver disease oor04940   Type I diabetes mellitus oor05133   Pertussis oor05134   Legionellosis oor05140   Leishmaniasis oor05142   Chagas disease oor05143   African trypanosomiasis oor05144   Malaria oor05145   Toxoplasmosis oor05146   Amoebiasis oor05152   Tuberculosis oor05162   Measles oor05164   Influenza A oor05168   Herpes simplex virus 1 infection oor05171   Coronavirus disease - COVID-19 oor05200   Pathways in cancer oor05321   Inflammatory bowel disease oor05330   Allograft rejection oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101279088 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101279088 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101279088 (IL12A)    04622 RIG-I-like receptor signaling pathway     101279088 (IL12A)    04625 C-type lectin receptor signaling pathway     101279088 (IL12A)    04658 Th1 and Th2 cell differentiation     101279088 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101279088 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101279088 (IL12A)    05164 Influenza A     101279088 (IL12A)    05162 Measles     101279088 (IL12A)    05168 Herpes simplex virus 1 infection     101279088 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     101279088 (IL12A)    05134 Legionellosis     101279088 (IL12A)    05152 Tuberculosis     101279088 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     101279088 (IL12A)    05144 Malaria     101279088 (IL12A)    05145 Toxoplasmosis     101279088 (IL12A)    05140 Leishmaniasis     101279088 (IL12A)    05142 Chagas disease     101279088 (IL12A)    05143 African trypanosomiasis     101279088 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     101279088 (IL12A)    05330 Allograft rejection     101279088 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101279088 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101279088 (IL12A)    04936 Alcoholic liver disease     101279088 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101279088 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101279088 (IL12A) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interleukins    101279088 (IL12A) Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Cytokines    101279088 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  101279088 NCBI-ProteinID:  XP_004281899 LinkDB All DBs Position 5:44808885..44816386 Genome browser AA seq 221 aa AA seqDB search MCPPRRLLLVATLVLLHHLDHFSLARSLPATTAGPGMFQCLNHSQNLLRAVSNTLEKARQ TLEFYSCTSEEIDHEDITKDRTSTVEACLPLELATNESCLASRETSLITNGSCLASRRSS FMTTLCLSSIYEDLKMYHMEFQAMNAKLLMDPKRQIFVDQDMLAAIAELMQALNSHSKIV SQKPSLEELDFYKTKVKLCILLHAFRIRVVTIDRMMSYLSS NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgcctcgcagactcctccttgtggccaccctggtcctcctccaccacctggac cactttagtttggccaggagcctacccgccaccacagcgggccccggaatgttccagtgc ctcaaccactcccaaaacctgctgagagccgtcagcaacacccttgagaaggccagacaa accctagaattttactcctgcacttctgaagagattgatcatgaagatatcaccaaagat agaaccagcacagtggaggcctgcttaccactggaattagccacgaatgagagttgcctg gcttccagagagacctctttaataactaatgggagttgcctggcttccagaaggagctct tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccacatggag ttccaggccatgaacgcaaagctcctgatggatcctaagaggcagatctttgtggatcag gacatgctggcggctattgctgagctgatgcaggccctgaattcccacagcaagattgtg tcacagaaaccctccctggaagaactggatttttataagactaaagtcaagctctgcata cttcttcatgccttcagaattcgtgtggtgaccatcgacagaatgatgagctatctgagt tcttaa

DBGET integrated database retrieval system