Orcinus orca (killer whale): 101279258 Help Entry 101279258         CDS       T05247                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism oor  Orcinus orca (killer whale) Pathway oor04014   Ras signaling pathway oor04137   Mitophagy - animal oor04144   Endocytosis oor04145   Phagosome oor04148   Efferocytosis oor04962   Vasopressin-regulated water reabsorption oor05132   Salmonella infection oor05146   Amoebiasis oor05152   Tuberculosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101279258 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101279258 (RAB5C)    04145 Phagosome     101279258 (RAB5C)    04137 Mitophagy - animal     101279258 (RAB5C)    04148 Efferocytosis     101279258 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     101279258 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101279258 (RAB5C)    05152 Tuberculosis     101279258 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     101279258 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     101279258 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oor04147]     101279258 (RAB5C)    04031 GTP-binding proteins [BR:oor04031]     101279258 (RAB5C) Membrane trafficking [BR:oor04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     101279258 (RAB5C)  Endosome - Lysosome transport     101279258 (RAB5C) Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101279258 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    101279258 (RAB5C)   Exosomal proteins of colorectal cancer cells    101279258 (RAB5C)   Exosomal proteins of bladder cancer cells    101279258 (RAB5C) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     101279258 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  101279258 NCBI-ProteinID:  XP_004282855 LinkDB All DBs Position 19:40971673..40994195 Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNTACAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcacgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcagtgggcaaatccagcctcgtcctccgc tttgtcaagggtcaattccacgagtaccaggagagcacaattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tacgacatcaccaacacagatacgtttgcacgggccaagaactgggtgaaggagttgcag aggcaggccagccccaacatcgtcatcgcgctcgcgggcaacaaggccgacctggccagc aagagagccgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttt atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgagccccagaatacagcttgtgctccgggccggaaccgaggagtg gacctccaggagaacaaccctgccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system