Orcinus orca (killer whale): 101279595 Help Entry 101279595         CDS       T05247                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism oor  Orcinus orca (killer whale) Pathway oor04814   Motor proteins oor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oor00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     101279595 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101279595 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oor03037]     101279595 (DYNLT3)    04812 Cytoskeleton proteins [BR:oor04812]     101279595 (DYNLT3) Cilium and associated proteins [BR:oor03037]  Motile cilia and associated proteins   Dynein arm    101279595 (DYNLT3) Cytoskeleton proteins [BR:oor04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101279595 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  101279595 NCBI-ProteinID:  XP_004281381 LinkDB All DBs Position X:complement(34308085..34318793) Genome browser AA seq 116 aa AA seqDB search MEEYHRPCDEVGFNADEAHNIVKECIDGVLGGEDYNHNNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgcccctgcgacgaggtcggcttcaatgctgatgaagcccacaat atcgttaaagagtgtatagatggggtcttgggaggtgaagattataatcataacaacatc aaccaatggaccgcaagcatagtggaacaatccttagcacatctggttaagctgggaaaa gcttataagtatattgtgacctgtgcggtggtccagaggagtgcatatggctttcacaca gccagctcatgtttttgggacaccacatctgatggaacctgtactgtaagatgggaaaac cgaaccatgaactgtattgtcaatgtctttgccattgctattgtcctgtaa

DBGET integrated database retrieval system