Orcinus orca (killer whale): 101280462 Help Entry 101280462         CDS       T05247                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y isoform X2   KO K05232   neuropeptide Y Organism oor  Orcinus orca (killer whale) Pathway oor04024   cAMP signaling pathway oor04080   Neuroactive ligand-receptor interaction oor04920   Adipocytokine signaling pathway oor04923   Regulation of lipolysis in adipocytes oor05034   Alcoholism Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     101280462 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101280462 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     101280462 (NPY)    04920 Adipocytokine signaling pathway     101280462 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     101280462 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101280462 (NPY) Cytokines and neuropeptides [BR:oor04052]  Neuropeptides   Neuropeptides (GPCR binding)    101280462 (NPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  101280462 NCBI-ProteinID:  XP_004265685 LinkDB All DBs Position 9:complement(51230132..51240806) Genome browser AA seq 97 aa AA seqDB search MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPNNPGEDAPAEDLARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESMENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgactggggctgtccggactgaccctcgccctgtccctgctcgtg tgcctgggagctctggccgaggcgtacccctccaagcccaacaaccccggagaggacgcg ccggcggaggacttggccagatactactcggcgctgcgacactacatcaatctcatcacc aggcaaagatatggaaaacgatctagccctgagacactgatttcagacctcttgatgaga gaaagcatggaaaacgttcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system