Orcinus orca (killer whale): 101281814 Help Entry 101281814         CDS       T05247                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism oor  Orcinus orca (killer whale) Pathway oor04015   Rap1 signaling pathway oor04810   Regulation of actin cytoskeleton oor05014   Amyotrophic lateral sclerosis oor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101281814 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101281814 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101281814 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101281814 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     101281814 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oor04812]     101281814 (PFN4)    04147 Exosome [BR:oor04147]     101281814 (PFN4) Membrane trafficking [BR:oor04131]  Others   Actin-binding proteins    Others     101281814 (PFN4) Cytoskeleton proteins [BR:oor04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101281814 (PFN4) Exosome [BR:oor04147]  Exosomal proteins   Proteins found in most exosomes    101281814 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101281814 NCBI-ProteinID:  XP_004268133 LinkDB All DBs Position 13:73225060..73230519 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQEPSLCVASPGFSVMPSDVRTLVDGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKSENTGVVVVKTRLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacgaagcatgtagacagt gcagccctcatcaaactccaggagccgagcctatgtgtagcatcacctggatttagtgta atgcccagtgatgtccgaacacttgtggatggatttgccaagaaccctttgaaaaccaga agagaaggattgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagagtgaaaatactggtgtggttgttgtgaagacccgtctgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagaaattg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system