Orcinus orca (killer whale): 101281979 Help Entry 101281979         CDS       T05247                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism oor  Orcinus orca (killer whale) Pathway oor04978   Mineral absorption Brite KEGG Orthology (KO) [BR:oor00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     101281979  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:oor03019]     101281979    03029 Mitochondrial biogenesis [BR:oor03029]     101281979 Messenger RNA biogenesis [BR:oor03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      101281979 Mitochondrial biogenesis [BR:oor03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     101281979 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  101281979 NCBI-ProteinID:  XP_004272515 LinkDB All DBs Position 1:complement(198285899..198286296) Genome browser AA seq 61 aa AA seqDB search MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVSYAKCAQGCVCKGASDEGSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccaactgctcctgtgccacaggcggatcctgcacgtgtgccggctcctgcaaa tgcaaagagtgcaaatgcacctcctgcaaaaagagctgctgctcctgctgccctgtgagc tatgccaagtgtgcccagggctgtgtctgcaaaggggcctcagacgagggcagctgctgc gcctga

DBGET integrated database retrieval system