Orcinus orca (killer whale): 101283207 Help Entry 101283207         CDS       T05247                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism oor  Orcinus orca (killer whale) Pathway oor04613   Neutrophil extracellular trap formation oor05034   Alcoholism oor05203   Viral carcinogenesis oor05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oor00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101283207  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101283207   09163 Immune disease    05322 Systemic lupus erythematosus     101283207   09165 Substance dependence    05034 Alcoholism     101283207  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oor03036]     101283207   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oor04147]     101283207 Chromosome and associated proteins [BR:oor03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101283207 Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101283207 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101283207 NCBI-ProteinID:  XP_033272962 LinkDB All DBs Position 10:complement(84328197..84328779) Genome browser AA seq 126 aa AA seqDB search MPESAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagtcggctaaatctgccccggctccgaagaaggggtccaagaaagcggtgacc aaggcccagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagctactctatc tacgtgtacaaagtgctgaagcaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgtttgtcaacgacattttcgagcgcatcgcgggtgagtcgtcgcgc ctggcgcattacaacaagcgttcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcactaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system