KEGG   Orcinus orca (killer whale): 101283438
Entry
101283438         CDS       T05247                                 
Symbol
ATF4
Name
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04137  Mitophagy - animal
oor04141  Protein processing in endoplasmic reticulum
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04261  Adrenergic signaling in cardiomyocytes
oor04668  TNF signaling pathway
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04728  Dopaminergic synapse
oor04911  Insulin secretion
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04918  Thyroid hormone synthesis
oor04922  Glucagon signaling pathway
oor04925  Aldosterone synthesis and secretion
oor04926  Relaxin signaling pathway
oor04927  Cortisol synthesis and secretion
oor04928  Parathyroid hormone synthesis, secretion and action
oor04932  Non-alcoholic fatty liver disease
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05012  Parkinson disease
oor05014  Amyotrophic lateral sclerosis
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05030  Cocaine addiction
oor05031  Amphetamine addiction
oor05034  Alcoholism
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05203  Viral carcinogenesis
oor05207  Chemical carcinogenesis - receptor activation
oor05215  Prostate cancer
oor05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101283438 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101283438 (ATF4)
   04668 TNF signaling pathway
    101283438 (ATF4)
   04022 cGMP-PKG signaling pathway
    101283438 (ATF4)
   04151 PI3K-Akt signaling pathway
    101283438 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101283438 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    101283438 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101283438 (ATF4)
   04922 Glucagon signaling pathway
    101283438 (ATF4)
   04912 GnRH signaling pathway
    101283438 (ATF4)
   04915 Estrogen signaling pathway
    101283438 (ATF4)
   04926 Relaxin signaling pathway
    101283438 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    101283438 (ATF4)
   04918 Thyroid hormone synthesis
    101283438 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    101283438 (ATF4)
   04925 Aldosterone synthesis and secretion
    101283438 (ATF4)
   04927 Cortisol synthesis and secretion
    101283438 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101283438 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    101283438 (ATF4)
   04728 Dopaminergic synapse
    101283438 (ATF4)
   04720 Long-term potentiation
    101283438 (ATF4)
   04722 Neurotrophin signaling pathway
    101283438 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    101283438 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    101283438 (ATF4)
   05203 Viral carcinogenesis
    101283438 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101283438 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101283438 (ATF4)
   05161 Hepatitis B
    101283438 (ATF4)
   05163 Human cytomegalovirus infection
    101283438 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101283438 (ATF4)
   05012 Parkinson disease
    101283438 (ATF4)
   05014 Amyotrophic lateral sclerosis
    101283438 (ATF4)
   05020 Prion disease
    101283438 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    101283438 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    101283438 (ATF4)
   05031 Amphetamine addiction
    101283438 (ATF4)
   05034 Alcoholism
    101283438 (ATF4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101283438 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101283438 (ATF4)
   04934 Cushing syndrome
    101283438 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oor03000]
    101283438 (ATF4)
Transcription factors [BR:oor03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101283438 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 KIF21A Nop53 Asd-4 DUF3450 Fez1 OVT1 AAA_13 bZIP_Maf
Other DBs
NCBI-GeneID: 101283438
NCBI-ProteinID: XP_004279552
LinkDB
Position
11:94035138..94037229
AA seq 351 aa
MAEKSFLSSEVLVVDFMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSGDKAKAGFSE
WLAMDGLVSASDNGKEDAFSGTDWMVEKMDLKEFDFNALLGIDDLETMPDELLASLDDTC
DLFDPLLQEATKESPQLVNPIGHLPESLPTTDQGAPFTFLQPLPLSPGALFSTPDHSFTL
ELCSEVTSEEDRKPDSTAYLMLVPPCVKEEDAPSDNDSGICMSPDSYLGSPQHSPPTSRG
SPNRSLLSPGAPGGSARPKPYDPPGEKMIAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRTP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgagaagagcttcctgagcagcgaggtgttggtggtggacttcatgtcccccttc
gaccagtcgggtttgggggctgaagagagcctgggtctcctagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctctggcgacaaggctaaggcgggcttctccgaa
tggctggctatggatgggttggtcagtgcctcagataacggcaaggaggatgcgttctct
gggacagattggatggtggagaaaatggatctgaaggagtttgattttaatgctctgttg
ggtatagatgatctggaaaccatgccagatgagcttttggcctcgttggatgacacgtgt
gatctctttgaccccctactccaggaggctactaaggagtcccctcagcttgtgaaccca
ataggccatcttccagaaagtttgccaacaactgaccagggtgcccctttcactttcttg
cagcctcttcccctctccccaggggccctgttctccactccagatcattcttttacttta
gagctatgcagtgaagtgacgtctgaagaagataggaagccagactccactgcttacctt
atgctggtccctccgtgcgtaaaggaagaggatgccccctcagataatgatagtggcatc
tgtatgagccctgactcctatctgggctctccccagcatagcccccctacctccaggggt
tctccaaatagaagcctgctatctccaggtgcccctggtggctctgcccgccccaagccc
tatgaccctcctggagagaagatgatagcagcgaaagtaaagggtgagaaactagataag
aaactgaagaaaatggagcagaacaagacagcagccactaggtaccgccagaagaagagg
gcagagcaggaggccctcactggtgaatgtaaagagctagaaaagaagaatgaggctctg
aaagagaaggcagattccttggccaaggagatccagtatctgaaagatttaatagaagag
gtccgcaaggcaagggggaagaagaggaccccctag

DBGET integrated database retrieval system