Orcinus orca (killer whale): 101283498 Help Entry 101283498         CDS       T05247                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04061   Viral protein interaction with cytokine and cytokine receptor oor04062   Chemokine signaling pathway oor04620   Toll-like receptor signaling pathway oor05142   Chagas disease oor05163   Human cytomegalovirus infection oor05323   Rheumatoid arthritis oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101283498    04061 Viral protein interaction with cytokine and cytokine receptor     101283498  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101283498    04062 Chemokine signaling pathway     101283498  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101283498   09174 Infectious disease: parasitic    05142 Chagas disease     101283498   09163 Immune disease    05323 Rheumatoid arthritis     101283498   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101283498  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101283498    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101283498 Cytokines and neuropeptides [BR:oor04052]  Cytokines   Chemokines    101283498 Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Chemokines    101283498 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Duc1_FFAT_like PspC Motif Other DBs NCBI-GeneID:  101283498 NCBI-ProteinID:  XP_049558482 LinkDB All DBs Position 19:47189568..47191534 Genome browser AA seq 119 aa AA seqDB search MCLLEIDFFDMDASAVRLWFPLGVCFLRLRGIIIYITAVPSAGDQSVLFLTVGANTPTAC CFSYISWQIPCKFMDDYYETSRQCSKPSVIFQTKRGQEVCADPNEDRVQEYITDLELSA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtgcttactcgagatagatttctttgatatggatgcctcagcagtcaggctatggttt ccccttggggtgtgcttcttaagactccgtggcattatcatctacatcacagctgtgccg tcagctggggatcaatctgtcctgtttctcacggttggtgccaacaccccgaccgcctgc tgcttctcctacatctcctggcagatcccgtgtaaattcatggatgactattatgagacc agccgccagtgctcaaagcccagtgtcatcttccaaaccaaaagaggccaggaggtctgt gccgaccccaatgaggacagagtccaggaatacatcactgacctggagctgagtgcctga

DBGET integrated database retrieval system