Orcinus orca (killer whale): 101283789 Help Entry 101283789         CDS       T05247                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism oor  Orcinus orca (killer whale) Pathway oor04022   cGMP-PKG signaling pathway oor04081   Hormone signaling oor04270   Vascular smooth muscle contraction oor05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     101283789 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     101283789 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     101283789 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101283789 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101283789 (NPPC) Cytokines and neuropeptides [BR:oor04052]  Neuropeptides   Unclassified    101283789 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  101283789 NCBI-ProteinID:  XP_004262642 LinkDB All DBs Position 7:complement(112839320..112844144) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLALLSLRPSEAKPGAPPKVPRTPPGEEVAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcgcgctactctcgctccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgcactccgccaggggaggaggtg gccgagccccaggctgcgggaggaggtcagaagaagggcgacaagactcccgggggtggc ggcgccaatctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tctcgggcggcgtgggcccgtcttctgcaagagcaccccaacgcgcggaaatacaaggga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggacaggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system