Orcinus orca (killer whale): 101283820 Help Entry 101283820         CDS       T05247                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism oor  Orcinus orca (killer whale) Pathway oor04144   Endocytosis Brite KEGG Orthology (KO) [BR:oor00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101283820 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     101283820 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oor04147]     101283820 (ARF4)    04031 GTP-binding proteins [BR:oor04031]     101283820 (ARF4) Membrane trafficking [BR:oor04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     101283820 (ARF4) Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101283820 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    101283820 (ARF4)   Exosomal proteins of colorectal cancer cells    101283820 (ARF4) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101283820 (ARF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU Motif Other DBs NCBI-GeneID:  101283820 NCBI-ProteinID:  XP_004267994 LinkDB All DBs Position 10:31588960..31608265 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAEELQKMLQEDELRDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctctctcttctcccgtctcttcggcaagaagcagatgcgcatt ttgatggttgggttggatgctgctggcaagaccaccattctgtataaactgaagttagga gagatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac atttgtttcacagtatgggatgttggtggtcaagataaaattaggcctctctggaggcat tacttccaaaatacccagggtcttatttttgtggtagatagcaatgatcgtgaaagaatt caggaaggagcagaagagctgcagaaaatgcttcaggaagatgagctgcgagatgctgtg ttgctgctttttgcaaacaaacaggatttgccgaatgctatggccattagtgaaatgaca gataaattaggtcttcagtctcttcgtaacagaacatggtatgttcaagccacttgtgct acacaaggaaccggtctgtatgagggacttgactggctgtcaaatgagctttcaaaacgt taa

DBGET integrated database retrieval system