KEGG   Orcinus orca (killer whale): 101284096
Entry
101284096         CDS       T05247                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04020  Calcium signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04371  Apelin signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04713  Circadian entrainment
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04728  Dopaminergic synapse
oor04740  Olfactory transduction
oor04744  Phototransduction
oor04750  Inflammatory mediator regulation of TRP channels
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04921  Oxytocin signaling pathway
oor04922  Glucagon signaling pathway
oor04924  Renin secretion
oor04925  Aldosterone synthesis and secretion
oor04970  Salivary secretion
oor04971  Gastric acid secretion
oor05010  Alzheimer disease
oor05012  Parkinson disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05031  Amphetamine addiction
oor05034  Alcoholism
oor05133  Pertussis
oor05152  Tuberculosis
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05214  Glioma
oor05417  Lipid and atherosclerosis
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101284096
   04015 Rap1 signaling pathway
    101284096
   04371 Apelin signaling pathway
    101284096
   04020 Calcium signaling pathway
    101284096
   04070 Phosphatidylinositol signaling system
    101284096
   04024 cAMP signaling pathway
    101284096
   04022 cGMP-PKG signaling pathway
    101284096
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101284096
   04218 Cellular senescence
    101284096
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101284096
  09152 Endocrine system
   04910 Insulin signaling pathway
    101284096
   04922 Glucagon signaling pathway
    101284096
   04912 GnRH signaling pathway
    101284096
   04915 Estrogen signaling pathway
    101284096
   04921 Oxytocin signaling pathway
    101284096
   04916 Melanogenesis
    101284096
   04924 Renin secretion
    101284096
   04925 Aldosterone synthesis and secretion
    101284096
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101284096
   04270 Vascular smooth muscle contraction
    101284096
  09154 Digestive system
   04970 Salivary secretion
    101284096
   04971 Gastric acid secretion
    101284096
  09156 Nervous system
   04728 Dopaminergic synapse
    101284096
   04720 Long-term potentiation
    101284096
   04722 Neurotrophin signaling pathway
    101284096
  09157 Sensory system
   04744 Phototransduction
    101284096
   04740 Olfactory transduction
    101284096
   04750 Inflammatory mediator regulation of TRP channels
    101284096
  09159 Environmental adaptation
   04713 Circadian entrainment
    101284096
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101284096
  09162 Cancer: specific types
   05214 Glioma
    101284096
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101284096
   05163 Human cytomegalovirus infection
    101284096
   05167 Kaposi sarcoma-associated herpesvirus infection
    101284096
  09171 Infectious disease: bacterial
   05133 Pertussis
    101284096
   05152 Tuberculosis
    101284096
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101284096
   05012 Parkinson disease
    101284096
   05022 Pathways of neurodegeneration - multiple diseases
    101284096
  09165 Substance dependence
   05031 Amphetamine addiction
    101284096
   05034 Alcoholism
    101284096
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101284096
   05418 Fluid shear stress and atherosclerosis
    101284096
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101284096
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101284096
   03036 Chromosome and associated proteins [BR:oor03036]
    101284096
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101284096
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101284096
Membrane trafficking [BR:oor04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    101284096
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     101284096
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101284096
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 Dockerin_1 UPF0154 EFhand_Ca_insen TerB Caleosin DUF1103 Poly_export SurA_N_3 DUF5580_M Fe_hyd_lg_C MecA_N MotA_activ RloB
Other DBs
NCBI-GeneID: 101284096
NCBI-ProteinID: XP_033293106
LinkDB
Position
10:complement(9947740..9948883)
AA seq 149 aa
MADQLTEEQMAEFKEAFSLFDKDGDGTVTTEELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTIMARKMKDTDSEEEIREAFLVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccagctgactgaagagcagatggcagaattcaaagaagctttttcactattt
gacaaggatggtgatggaactgtaacaacagaggagttgggaactgtaatgaggtctctt
gggcagaatcccacagaagcagagttacaggacatgattaatgaggtggatgctgatggt
aatggcacaattgacttcccggaatttctgacaatcatggcaagaaagatgaaagacaca
gacagtgaagaagaaattagagaagcattccttgtgtttgataaggatggtaatggctat
attagtgcagcagagctccgccatgtgatgacaaatcttggagagaagttaacagacgaa
gaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa
gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system