Orcinus orca (killer whale): 101284892 Help Entry 101284892         CDS       T05247                                  Symbol IL1B Name (RefSeq) interleukin-1 beta isoform X2   KO K04519   interleukin 1 beta Organism oor  Orcinus orca (killer whale) Pathway oor01523   Antifolate resistance oor04010   MAPK signaling pathway oor04060   Cytokine-cytokine receptor interaction oor04064   NF-kappa B signaling pathway oor04217   Necroptosis oor04380   Osteoclast differentiation oor04620   Toll-like receptor signaling pathway oor04621   NOD-like receptor signaling pathway oor04623   Cytosolic DNA-sensing pathway oor04625   C-type lectin receptor signaling pathway oor04640   Hematopoietic cell lineage oor04657   IL-17 signaling pathway oor04659   Th17 cell differentiation oor04668   TNF signaling pathway oor04750   Inflammatory mediator regulation of TRP channels oor04932   Non-alcoholic fatty liver disease oor04933   AGE-RAGE signaling pathway in diabetic complications oor04936   Alcoholic liver disease oor04940   Type I diabetes mellitus oor05010   Alzheimer disease oor05020   Prion disease oor05022   Pathways of neurodegeneration - multiple diseases oor05132   Salmonella infection oor05133   Pertussis oor05134   Legionellosis oor05135   Yersinia infection oor05140   Leishmaniasis oor05142   Chagas disease oor05143   African trypanosomiasis oor05144   Malaria oor05146   Amoebiasis oor05152   Tuberculosis oor05162   Measles oor05163   Human cytomegalovirus infection oor05164   Influenza A oor05168   Herpes simplex virus 1 infection oor05171   Coronavirus disease - COVID-19 oor05321   Inflammatory bowel disease oor05323   Rheumatoid arthritis oor05332   Graft-versus-host disease oor05417   Lipid and atherosclerosis oor05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101284892 (IL1B)    04064 NF-kappa B signaling pathway     101284892 (IL1B)    04668 TNF signaling pathway     101284892 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101284892 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101284892 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101284892 (IL1B)    04620 Toll-like receptor signaling pathway     101284892 (IL1B)    04621 NOD-like receptor signaling pathway     101284892 (IL1B)    04623 Cytosolic DNA-sensing pathway     101284892 (IL1B)    04625 C-type lectin receptor signaling pathway     101284892 (IL1B)    04659 Th17 cell differentiation     101284892 (IL1B)    04657 IL-17 signaling pathway     101284892 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     101284892 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     101284892 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101284892 (IL1B)    05164 Influenza A     101284892 (IL1B)    05162 Measles     101284892 (IL1B)    05168 Herpes simplex virus 1 infection     101284892 (IL1B)    05163 Human cytomegalovirus infection     101284892 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     101284892 (IL1B)    05135 Yersinia infection     101284892 (IL1B)    05133 Pertussis     101284892 (IL1B)    05134 Legionellosis     101284892 (IL1B)    05152 Tuberculosis     101284892 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     101284892 (IL1B)    05144 Malaria     101284892 (IL1B)    05140 Leishmaniasis     101284892 (IL1B)    05142 Chagas disease     101284892 (IL1B)    05143 African trypanosomiasis     101284892 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     101284892 (IL1B)    05321 Inflammatory bowel disease     101284892 (IL1B)    05332 Graft-versus-host disease     101284892 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     101284892 (IL1B)    05020 Prion disease     101284892 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     101284892 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101284892 (IL1B)    05418 Fluid shear stress and atherosclerosis     101284892 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101284892 (IL1B)    04936 Alcoholic liver disease     101284892 (IL1B)    04932 Non-alcoholic fatty liver disease     101284892 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     101284892 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101284892 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101284892 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101284892 (IL1B) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interleukins    101284892 (IL1B) Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Cytokines    101284892 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  101284892 NCBI-ProteinID:  XP_004285688 LinkDB All DBs Position 13:complement(11984166..12000520) Genome browser AA seq 266 aa AA seqDB search MATVPEPTNEVMAYYSDKNDLLFEADGPKQMKCCVQHLDLSSTGDESIHLQISHQLYNKS FRHVVSVIVAVEKLQKIPCSQTFQDDGLKSIFSLIFEEEPVIFETYDDDLLCDAAVQSLT CKLQDRDQKSLVLASPCVLKALHLLARDMNREVVFCMSFVQGDESNDKIPVALGLKEKNL YLSCVMKGDRPILQLEEVDPKTYPKWKMEKRFVFNKTEIKNSVEFESALYPNWYISTSQA EEKPIFLGRSKGGHDITDFTMEIISP NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggcaacggtacctgaacccaccaacgaagtgatggcttactacagtgacaagaatgac ctgttatttgaggctgacggccccaaacagatgaagtgctgcgtccaacacctggacctc agctccacgggagatgagagcatccacctgcaaatctcccaccagctctacaacaaaagc ttcaggcatgtggtgtcggtcatcgtggctgtggagaagctgcagaagatcccctgctca cagaccttccaggatgatggcctgaagagcatcttttcactcatctttgaagaagagcct gtcatctttgaaacgtacgacgatgatcttctgtgtgacgcggctgtgcagtcgctgacc tgcaaactccaggacagagaccaaaaatccctggtgctggctagcccgtgtgtgctgaag gctctccacctcctcgcacgggacatgaaccgagaagtggttttctgcatgagcttcgtg caaggagatgaaagtaacgacaagatacctgtggccttaggcctcaaggaaaagaatcta tacctgtcttgtgtgatgaaaggcgataggcccatcctgcagctggaggaggtagacccc aaaacttacccaaagtggaagatggaaaagcgatttgtcttcaacaagacagaaatcaag aatagcgtcgaatttgaatctgccctgtaccccaactggtacatcagcacctctcaagca gaagaaaagcccatcttcctaggacgttccaaaggcggccatgatataactgacttcacc atggaaatcatctctccctaa

DBGET integrated database retrieval system