Orcinus orca (killer whale): 101285419 Help Entry 101285419         CDS       T05247                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism oor  Orcinus orca (killer whale) Pathway oor04015   Rap1 signaling pathway oor04810   Regulation of actin cytoskeleton oor05014   Amyotrophic lateral sclerosis oor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101285419 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101285419 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101285419 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101285419 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     101285419 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oor04812]     101285419 (PFN1)    04147 Exosome [BR:oor04147]     101285419 (PFN1) Membrane trafficking [BR:oor04131]  Others   Actin-binding proteins    Others     101285419 (PFN1) Cytoskeleton proteins [BR:oor04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101285419 (PFN1) Exosome [BR:oor04147]  Exosomal proteins   Proteins found in most exosomes    101285419 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Pombe_5TM Motif Other DBs NCBI-GeneID:  101285419 NCBI-ProteinID:  XP_004267037 LinkDB All DBs Position 19:11169057..11171994 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIENLMADGVCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGTLVGKDRSSFF VNGLTLGGQKCSVIRDSLMQEGEFTMDLRTKSTSGAPTFNITVTLTTKTLVLLMGKEGIH GGTINKKCHEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcctacatcgaaaacctcatggcggacggggtgtgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggttggtaccctggttggcaaagaccggtcaagttttttc gtgaatgggctaacgcttgggggccagaaatgttctgtgatccgggactcactgatgcag gaaggggaatttaccatggatcttcgtaccaagagcacctccggagcccccaccttcaat atcactgtcaccctgactaccaagacgctagtcctgctgatgggcaaagaaggtatccac ggtggtacgatcaacaagaaatgtcatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system