Orcinus orca (killer whale): 101286477 Help Entry 101286477         CDS       T05247                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism oor  Orcinus orca (killer whale) Pathway oor04024   cAMP signaling pathway oor04080   Neuroactive ligand-receptor interaction oor04081   Hormone signaling oor04935   Growth hormone synthesis, secretion and action oor04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     101286477 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101286477 (SST)    04081 Hormone signaling     101286477 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     101286477 (SST)   09154 Digestive system    04971 Gastric acid secretion     101286477 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101286477 (SST) Cytokines and neuropeptides [BR:oor04052]  Neuropeptides   GPCR binding    101286477 (SST) SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  101286477 NCBI-ProteinID:  XP_033259131 LinkDB All DBs Position 5:complement(69373695..69378271) Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgtctccagtgcgcgctggccgcgctctccatagttctggctctgggc ggtgtcaccggcgcgccctcagatccccgactccgtcagtttctgcagaaatccctggct gctgccgctgggaagcaggaattggccaagtacttcttggcagagctgctctctgaaccc aaccagacagagaacgatgccctggagcctgaagatctgtcccaggctgctgaacaggat gaaatgaggctggagctgcagagatccgctaactcgaacccggccatggcgccccgagaa cgcaaagccggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system