Orcinus orca (killer whale): 101286818 Help Entry 101286818         CDS       T05247                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism oor  Orcinus orca (killer whale) Pathway oor04015   Rap1 signaling pathway oor04810   Regulation of actin cytoskeleton oor05014   Amyotrophic lateral sclerosis oor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101286818 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101286818 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101286818 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101286818 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oor04131]     101286818 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oor04812]     101286818 (PFN2)    04147 Exosome [BR:oor04147]     101286818 (PFN2) Membrane trafficking [BR:oor04131]  Others   Actin-binding proteins    Others     101286818 (PFN2) Cytoskeleton proteins [BR:oor04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101286818 (PFN2) Exosome [BR:oor04147]  Exosomal proteins   Proteins found in most exosomes    101286818 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101286818 NCBI-ProteinID:  XP_004278228 LinkDB All DBs Position 5:20152736..20160477 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TSGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtatgggcagccacagccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accagtggtttaactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system