Orcinus orca (killer whale): 101288063 Help Entry 101288063         CDS       T05247                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor01524   Platinum drug resistance oor04014   Ras signaling pathway oor04064   NF-kappa B signaling pathway oor04115   p53 signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04151   PI3K-Akt signaling pathway oor04210   Apoptosis oor04215   Apoptosis - multiple species oor04621   NOD-like receptor signaling pathway oor04630   JAK-STAT signaling pathway oor05012   Parkinson disease oor05014   Amyotrophic lateral sclerosis oor05022   Pathways of neurodegeneration - multiple diseases oor05145   Toxoplasmosis oor05162   Measles oor05166   Human T-cell leukemia virus 1 infection oor05168   Herpes simplex virus 1 infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05202   Transcriptional misregulation in cancer oor05212   Pancreatic cancer oor05220   Chronic myeloid leukemia oor05222   Small cell lung cancer oor05225   Hepatocellular carcinoma oor05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101288063 (BCL2L1)    04630 JAK-STAT signaling pathway     101288063 (BCL2L1)    04064 NF-kappa B signaling pathway     101288063 (BCL2L1)    04151 PI3K-Akt signaling pathway     101288063 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101288063 (BCL2L1)    04137 Mitophagy - animal     101288063 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     101288063 (BCL2L1)    04215 Apoptosis - multiple species     101288063 (BCL2L1)    04115 p53 signaling pathway     101288063 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101288063 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101288063 (BCL2L1)    05202 Transcriptional misregulation in cancer     101288063 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     101288063 (BCL2L1)    05225 Hepatocellular carcinoma     101288063 (BCL2L1)    05220 Chronic myeloid leukemia     101288063 (BCL2L1)    05222 Small cell lung cancer     101288063 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101288063 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     101288063 (BCL2L1)    05162 Measles     101288063 (BCL2L1)    05168 Herpes simplex virus 1 infection     101288063 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101288063 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     101288063 (BCL2L1)    05014 Amyotrophic lateral sclerosis     101288063 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     101288063 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101288063 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101288063 (BCL2L1)    01524 Platinum drug resistance     101288063 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oor01009]     101288063 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oor03036]     101288063 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:oor02000]     101288063 (BCL2L1) Protein phosphatases and associated proteins [BR:oor01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101288063 (BCL2L1) Chromosome and associated proteins [BR:oor03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101288063 (BCL2L1) Transporters [BR:oor02000]  Other transporters   Pores ion channels [TC:1]    101288063 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  101288063 NCBI-ProteinID:  XP_004272739 LinkDB All DBs Position 16:27495522..28366703 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVLLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaatcgggagctggtggttgactttctttcctacaagctttcccagaaa ggatacagctggagtcagtttagcgatgtggacgagaacagaactgaggccccagaaggg actgaatcagacatggaaacccccagtgccatcaatggcaacccatcctggcacctggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctatgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggcgtgcttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system