Orcinus orca (killer whale): 101288913 Help Entry 101288913         CDS       T05247                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism oor  Orcinus orca (killer whale) Pathway oor01522   Endocrine resistance oor04010   MAPK signaling pathway oor04012   ErbB signaling pathway oor04024   cAMP signaling pathway oor04137   Mitophagy - animal oor04210   Apoptosis oor04310   Wnt signaling pathway oor04380   Osteoclast differentiation oor04510   Focal adhesion oor04530   Tight junction oor04620   Toll-like receptor signaling pathway oor04621   NOD-like receptor signaling pathway oor04625   C-type lectin receptor signaling pathway oor04657   IL-17 signaling pathway oor04658   Th1 and Th2 cell differentiation oor04659   Th17 cell differentiation oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04668   TNF signaling pathway oor04722   Neurotrophin signaling pathway oor04912   GnRH signaling pathway oor04915   Estrogen signaling pathway oor04921   Oxytocin signaling pathway oor04926   Relaxin signaling pathway oor04932   Non-alcoholic fatty liver disease oor04933   AGE-RAGE signaling pathway in diabetic complications oor05030   Cocaine addiction oor05031   Amphetamine addiction oor05132   Salmonella infection oor05133   Pertussis oor05135   Yersinia infection oor05140   Leishmaniasis oor05142   Chagas disease oor05161   Hepatitis B oor05162   Measles oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05169   Epstein-Barr virus infection oor05170   Human immunodeficiency virus 1 infection oor05171   Coronavirus disease - COVID-19 oor05200   Pathways in cancer oor05203   Viral carcinogenesis oor05207   Chemical carcinogenesis - receptor activation oor05208   Chemical carcinogenesis - reactive oxygen species oor05210   Colorectal cancer oor05211   Renal cell carcinoma oor05224   Breast cancer oor05231   Choline metabolism in cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oor05321   Inflammatory bowel disease oor05323   Rheumatoid arthritis oor05417   Lipid and atherosclerosis oor05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101288913 (JUN)    04012 ErbB signaling pathway     101288913 (JUN)    04310 Wnt signaling pathway     101288913 (JUN)    04668 TNF signaling pathway     101288913 (JUN)    04024 cAMP signaling pathway     101288913 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101288913 (JUN)   09143 Cell growth and death    04210 Apoptosis     101288913 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101288913 (JUN)    04530 Tight junction     101288913 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101288913 (JUN)    04621 NOD-like receptor signaling pathway     101288913 (JUN)    04625 C-type lectin receptor signaling pathway     101288913 (JUN)    04660 T cell receptor signaling pathway     101288913 (JUN)    04658 Th1 and Th2 cell differentiation     101288913 (JUN)    04659 Th17 cell differentiation     101288913 (JUN)    04657 IL-17 signaling pathway     101288913 (JUN)    04662 B cell receptor signaling pathway     101288913 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     101288913 (JUN)    04915 Estrogen signaling pathway     101288913 (JUN)    04921 Oxytocin signaling pathway     101288913 (JUN)    04926 Relaxin signaling pathway     101288913 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     101288913 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     101288913 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101288913 (JUN)    05207 Chemical carcinogenesis - receptor activation     101288913 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     101288913 (JUN)    05203 Viral carcinogenesis     101288913 (JUN)    05231 Choline metabolism in cancer     101288913 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101288913 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     101288913 (JUN)    05211 Renal cell carcinoma     101288913 (JUN)    05224 Breast cancer     101288913 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101288913 (JUN)    05170 Human immunodeficiency virus 1 infection     101288913 (JUN)    05161 Hepatitis B     101288913 (JUN)    05171 Coronavirus disease - COVID-19     101288913 (JUN)    05162 Measles     101288913 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     101288913 (JUN)    05169 Epstein-Barr virus infection     101288913 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     101288913 (JUN)    05135 Yersinia infection     101288913 (JUN)    05133 Pertussis     101288913 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101288913 (JUN)    05142 Chagas disease     101288913 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     101288913 (JUN)    05321 Inflammatory bowel disease     101288913 (JUN)   09165 Substance dependence    05030 Cocaine addiction     101288913 (JUN)    05031 Amphetamine addiction     101288913 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101288913 (JUN)    05418 Fluid shear stress and atherosclerosis     101288913 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101288913 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     101288913 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101288913 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oor03000]     101288913 (JUN) Transcription factors [BR:oor03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     101288913 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  101288913 NCBI-ProteinID:  XP_004273839 LinkDB All DBs Position 1:163063798..163065604 Genome browser AA seq 345 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGGGGGGGGGGFGASLHSEPPVYANLSNF NPGALSGGGGGGGAPSYGAAGLAFPAQPQQQQPPPPPPPPPPHHLPQQIPVQHPRLQALK EEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKT LKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg aacctggccgaccccgtgggcagcctgaagccgcacctccgggccaagaactccgacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgtccc aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcctggtggccccggccgtggcctcggtggcgggcggcggcggtggcggcggcggcggc ggcggcttcggcgccagcctgcacagcgagccgccggtctacgccaacctcagcaacttc aacccgggcgcgctgagcggtggcggcggcggcggcggggcgccctcctacggcgcggcc ggcctggcctttcccgcgcagcctcagcagcagcagccgccgccgccgccgccgccgccg ccgccgcaccacctgccccagcagatccccgtgcagcacccgcggctgcaggccctgaag gaggagccgcagacggtccccgagatgcccggggaaacgccgcccctgtcccccatcgac atggagtcccaggagcggatcaaggcggagaggaagcgcatgaggaaccgcatcgctgcc tccaagtgccggaaaaggaagctggagaggatcgcccggctggaggaaaaagtgaaaacc ttgaaagcgcagaactcggagctggcgtccacggccaacatgctcagggaacaggtggcc cagcttaagcagaaagtcatgaaccacgttaacagtgggtgccaactcatgctaacgcag cagttgcaaacgttttga

DBGET integrated database retrieval system