Orcinus orca (killer whale): 101289183 Help Entry 101289183         CDS       T05247                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism oor  Orcinus orca (killer whale) Pathway oor04060   Cytokine-cytokine receptor interaction oor04630   JAK-STAT signaling pathway oor04640   Hematopoietic cell lineage oor04657   IL-17 signaling pathway oor04658   Th1 and Th2 cell differentiation oor04660   T cell receptor signaling pathway oor04664   Fc epsilon RI signaling pathway oor04672   Intestinal immune network for IgA production oor05200   Pathways in cancer oor05310   Asthma oor05320   Autoimmune thyroid disease oor05321   Inflammatory bowel disease oor05330   Allograft rejection Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101289183 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101289183 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101289183 (IL5)    04660 T cell receptor signaling pathway     101289183 (IL5)    04658 Th1 and Th2 cell differentiation     101289183 (IL5)    04657 IL-17 signaling pathway     101289183 (IL5)    04664 Fc epsilon RI signaling pathway     101289183 (IL5)    04672 Intestinal immune network for IgA production     101289183 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101289183 (IL5)   09163 Immune disease    05310 Asthma     101289183 (IL5)    05320 Autoimmune thyroid disease     101289183 (IL5)    05321 Inflammatory bowel disease     101289183 (IL5)    05330 Allograft rejection     101289183 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oor04052]     101289183 (IL5)    00536 Glycosaminoglycan binding proteins [BR:oor00536]     101289183 (IL5) Cytokines and neuropeptides [BR:oor04052]  Cytokines   Interleukins    101289183 (IL5) Glycosaminoglycan binding proteins [BR:oor00536]  Heparan sulfate / Heparin   Cytokines    101289183 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  101289183 NCBI-ProteinID:  XP_004279945 LinkDB All DBs Position 3:75466644..75469387 Genome browser AA seq 135 aa AA seqDB search MRMLLHLSLLALGAVYVCVIAVESPMNRLVAETLTLLSTHQTLLIGDGNLMIPTPEHTNH ELCIKEVFQGIDTLKNQTAQGDAVEKLFQNLFLIKEYIIDLQRKKCGGERWRVKQFLDYL QTFLKVINTEWTTES NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctggctcttggagctgtctacgtttgtgtcatt gctgtagaaagtcccatgaatagactggtggcagagaccttgacactgctctccactcat caaactctgctgataggtgacgggaacttgatgattcctactcccgaacatacaaatcac gaactatgcattaaagaagtctttcagggaatagacacactgaagaatcaaactgcacaa ggggatgccgtggaaaaactattccaaaacttgtttttaataaaagaatacataatagac ctccaaagaaagaagtgtggaggagaaagatggagagtaaaacaattcctagactacctg caaacttttcttaaggtgataaacaccgagtggacaacggaaagttga

DBGET integrated database retrieval system