KEGG   Orcinus orca (killer whale): 101289394
Entry
101289394         CDS       T05247                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04114  Oocyte meiosis
oor04140  Autophagy - animal
oor04148  Efferocytosis
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04350  TGF-beta signaling pathway
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04517  IgSF CAM signaling
oor04520  Adherens junction
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04713  Circadian entrainment
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04723  Retrograde endocannabinoid signaling
oor04724  Glutamatergic synapse
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor05010  Alzheimer disease
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05132  Salmonella infection
oor05133  Pertussis
oor05135  Yersinia infection
oor05140  Leishmaniasis
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05207  Chemical carcinogenesis - receptor activation
oor05208  Chemical carcinogenesis - reactive oxygen species
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101289394 (MAPK3)
   04012 ErbB signaling pathway
    101289394 (MAPK3)
   04014 Ras signaling pathway
    101289394 (MAPK3)
   04015 Rap1 signaling pathway
    101289394 (MAPK3)
   04350 TGF-beta signaling pathway
    101289394 (MAPK3)
   04370 VEGF signaling pathway
    101289394 (MAPK3)
   04371 Apelin signaling pathway
    101289394 (MAPK3)
   04668 TNF signaling pathway
    101289394 (MAPK3)
   04066 HIF-1 signaling pathway
    101289394 (MAPK3)
   04068 FoxO signaling pathway
    101289394 (MAPK3)
   04072 Phospholipase D signaling pathway
    101289394 (MAPK3)
   04071 Sphingolipid signaling pathway
    101289394 (MAPK3)
   04024 cAMP signaling pathway
    101289394 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101289394 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101289394 (MAPK3)
   04150 mTOR signaling pathway
    101289394 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    101289394 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101289394 (MAPK3)
   04148 Efferocytosis
    101289394 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101289394 (MAPK3)
   04210 Apoptosis
    101289394 (MAPK3)
   04218 Cellular senescence
    101289394 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101289394 (MAPK3)
   04520 Adherens junction
    101289394 (MAPK3)
   04540 Gap junction
    101289394 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101289394 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101289394 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101289394 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101289394 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101289394 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101289394 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101289394 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101289394 (MAPK3)
   04660 T cell receptor signaling pathway
    101289394 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101289394 (MAPK3)
   04659 Th17 cell differentiation
    101289394 (MAPK3)
   04657 IL-17 signaling pathway
    101289394 (MAPK3)
   04662 B cell receptor signaling pathway
    101289394 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101289394 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101289394 (MAPK3)
   04062 Chemokine signaling pathway
    101289394 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101289394 (MAPK3)
   04929 GnRH secretion
    101289394 (MAPK3)
   04912 GnRH signaling pathway
    101289394 (MAPK3)
   04915 Estrogen signaling pathway
    101289394 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101289394 (MAPK3)
   04917 Prolactin signaling pathway
    101289394 (MAPK3)
   04921 Oxytocin signaling pathway
    101289394 (MAPK3)
   04926 Relaxin signaling pathway
    101289394 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101289394 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101289394 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101289394 (MAPK3)
   04916 Melanogenesis
    101289394 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101289394 (MAPK3)
   04270 Vascular smooth muscle contraction
    101289394 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101289394 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101289394 (MAPK3)
   04725 Cholinergic synapse
    101289394 (MAPK3)
   04726 Serotonergic synapse
    101289394 (MAPK3)
   04720 Long-term potentiation
    101289394 (MAPK3)
   04730 Long-term depression
    101289394 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101289394 (MAPK3)
   04722 Neurotrophin signaling pathway
    101289394 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101289394 (MAPK3)
   04380 Osteoclast differentiation
    101289394 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101289394 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101289394 (MAPK3)
   05206 MicroRNAs in cancer
    101289394 (MAPK3)
   05205 Proteoglycans in cancer
    101289394 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101289394 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101289394 (MAPK3)
   05203 Viral carcinogenesis
    101289394 (MAPK3)
   05230 Central carbon metabolism in cancer
    101289394 (MAPK3)
   05231 Choline metabolism in cancer
    101289394 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101289394 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101289394 (MAPK3)
   05212 Pancreatic cancer
    101289394 (MAPK3)
   05225 Hepatocellular carcinoma
    101289394 (MAPK3)
   05226 Gastric cancer
    101289394 (MAPK3)
   05214 Glioma
    101289394 (MAPK3)
   05216 Thyroid cancer
    101289394 (MAPK3)
   05221 Acute myeloid leukemia
    101289394 (MAPK3)
   05220 Chronic myeloid leukemia
    101289394 (MAPK3)
   05218 Melanoma
    101289394 (MAPK3)
   05211 Renal cell carcinoma
    101289394 (MAPK3)
   05219 Bladder cancer
    101289394 (MAPK3)
   05215 Prostate cancer
    101289394 (MAPK3)
   05213 Endometrial cancer
    101289394 (MAPK3)
   05224 Breast cancer
    101289394 (MAPK3)
   05223 Non-small cell lung cancer
    101289394 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101289394 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101289394 (MAPK3)
   05161 Hepatitis B
    101289394 (MAPK3)
   05160 Hepatitis C
    101289394 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101289394 (MAPK3)
   05164 Influenza A
    101289394 (MAPK3)
   05163 Human cytomegalovirus infection
    101289394 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101289394 (MAPK3)
   05165 Human papillomavirus infection
    101289394 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101289394 (MAPK3)
   05135 Yersinia infection
    101289394 (MAPK3)
   05133 Pertussis
    101289394 (MAPK3)
   05152 Tuberculosis
    101289394 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101289394 (MAPK3)
   05140 Leishmaniasis
    101289394 (MAPK3)
   05142 Chagas disease
    101289394 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101289394 (MAPK3)
   05020 Prion disease
    101289394 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101289394 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101289394 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101289394 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101289394 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101289394 (MAPK3)
   04934 Cushing syndrome
    101289394 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101289394 (MAPK3)
   01524 Platinum drug resistance
    101289394 (MAPK3)
   01522 Endocrine resistance
    101289394 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101289394 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101289394 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101289394 (MAPK3)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101289394 (MAPK3)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101289394 (MAPK3)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101289394 (MAPK3)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101289394 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101289394
NCBI-ProteinID: XP_004268688
LinkDB
Position
16:71609245..71615918
AA seq 383 aa
MAAAAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMV
SSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMR
DVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINT
TCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILA
EMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLF
PKSDPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLP
KERLKELIFQETARFQPGVLEAP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcggctcaggggggcgggggcggggagccccgggga
actgacggggtcggcccgggggtcccgggggaagtagagatagtaaaggggcagccgttc
gacgtgggcccgcgctacacgcagctgcagtacatcggcgagggcgcgtatggcatggtc
agctcagcttacgaccacgtgcgtaagactcgagtggccatcaagaaaatcagccccttt
gagcatcagacctactgccagcgtacgttgcgagagatccagatcttgctgcgcttccgc
cacgagaacgtcatcggcatccgagacattctgcgggcacccaccctggaagccatgagg
gatgtctacattgtgcaagacctgatggagacagacctgtacaagttgcttaaaagccag
cagctgagcaacgaccacatctgctacttcctctaccaaatcctgcggggcctcaagtat
atccattccgccaacgtgctccaccgggatttaaagccctccaacctgctcattaacacc
acctgcgaccttaagatctgtgattttggtcttgcccggattgccgatcctgagcacgac
cacactggctttctgacggaatacgtggctacacgctggtaccgggccccagagatcatg
cttaactccaagggctacaccaagtccatcgacatctggtctgtgggctgcattctggct
gagatgctctccaaccggcccatcttcccgggcaagcactacctggaccagctcaaccac
attctgggtatcctgggctccccctcccaggaggacctgaattgtatcatcaacatgaag
gcccgaaactacctacagtctctaccctccaagaccaaggtggcctgggccaagcttttt
cccaagtcggaccccaaagctcttgacctgctggaccggatgttgacctttaaccctaac
aaacggatcacagtggaagaagcactggctcacccctacctggagcagtactacgaccca
acagatgagccagtggccgaggaacctttcaccttcgacatggagctggatgatctaccc
aaggagcggctgaaggagctcatcttccaggagacagcccgtttccagcctggggtgctg
gaggccccctaa

DBGET integrated database retrieval system